KEGG   Homo sapiens (human): 951Help
Entry
951               CDS       T01001                                 

Gene name
CD37, GP52-40, TSPAN26
Definition
(RefSeq) CD37 molecule
  KO
K06475  CD37 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    951 (CD37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    951 (CD37)
   04090 CD molecules [BR:hsa04090]
    951 (CD37)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   951 (CD37)
CD molecules [BR:hsa04090]
 Proteins
  951 (CD37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspannin
Motif
Other DBs
NCBI-GeneID: 951
NCBI-ProteinID: NP_001765
OMIM: 151523
HGNC: 1666
Ensembl: ENSG00000104894
Vega: OTTHUMG00000183183
Pharos: P11049(Tbio)
UniProt: P11049
Position
19q13.33
AA seq 281 aa AA seqDB search
MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV
LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR
DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS
CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN
NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcccaggagagctgcctcagcctcatcaagtacttcctcttcgttttcaacctc
ttcttcttcgtcctcggcagcctgatcttctgcttcggcatctggatcctcattgacaag
accagcttcgtgtcctttgtgggcttggccttcgtgcctctgcagatctggtccaaagtc
ctggccatctcaggaatcttcaccatgggcatcgccctcctgggttgtgtgggggccctc
aaggagctccgctgcctcctgggcctgtattttgggatgctgctgctcctgtttgccaca
cagatcaccctgggaatcctcatctccactcagcgggcccagctggagcgaagcttgcgg
gacgtcgtagagaaaaccatccaaaagtacggcaccaaccccgaggagaccgcggccgag
gagagctgggactatgtgcagttccagctgcgctgctgcggctggcactacccgcaggac
tggttccaagtcctcatcctgagaggtaacgggtcggaggcgcaccgcgtgccctgctcc
tgctacaacttgtcggcgaccaacgactccacaatcctagataaggtgatcttgccccag
ctcagcaggcttggacacctggcgcggtccagacacagtgcagacatctgcgctgtccct
gcagagagccacatctaccgcgagggctgcgcgcagggcctccagaagtggctgcacaac
aaccttatttccatagtgggcatttgcctgggcgtcggcctactcgagctcgggttcatg
acgctctcgatattcctgtgcagaaacctggaccacgtctacaaccggctcgctcgatac
cgttag

DBGET integrated database retrieval system