KEGG   Homo sapiens (human): 9510Help
Entry
9510              CDS       T01001                                 

Gene name
ADAMTS1, C3-C5, METH1
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 1
  KO
K08617  a disintegrin and metalloproteinase with thrombospondin motifs 1 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    9510 (ADAMTS1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     9510 (ADAMTS1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   9510 (ADAMTS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADAM_spacer1 Pep_M12B_propep ADAM_CR_2 Reprolysin TSP_1 Reprolysin_5 Reprolysin_3 Reprolysin_4 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 9510
NCBI-ProteinID: NP_008919
OMIM: 605174
HGNC: 217
Ensembl: ENSG00000154734
Vega: OTTHUMG00000078688
Pharos: Q9UHI8(Tchem)
UniProt: Q9UHI8 B2RB33
Structure
PDB: 

Position
21q21.3
AA seq 967 aa AA seqDB search
MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL
VVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDL
AHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAP
LQFHLLRRNRQGDVGGTCGVVDDEPRPTGKAETEDEDEGTEGEDEGAQWSPQDPALQGVG
QPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQD
LCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGT
SYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWC
INGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNLEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKL
ICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGN
GSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILN
GDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDF
CTMAECS
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgagctgtgcccgaggggttcggaaggcgcaagctgggcagcgacatggggaac
gcggagcgggctccggggtctcggagctttgggccagtacccacgctgctgctgctcgcc
gcggcgctactggccgtgtcggacgcactcgggcgcccctccgaggaggacgaggagcta
gtggtgccggagctggagcgcgccccgggacacgggaccacgcgcctccgcctgcacgcc
tttgaccagcagctggatctggagctgcggcccgacagcagctttttggcgcccggcttc
acgctccagaacgtggggcgcaaatccgggtccgagacgccgcttccggaaaccgacctg
gcgcactgcttctactccggcaccgtgaatggcgatcccagctcggctgccgccctcagc
ctctgcgagggcgtgcgcggcgccttctacctgctgggggaggcgtatttcatccagccg
ctgcccgccgccagcgagcgcctcgccaccgccgccccaggggagaagccgccggcacca
ctacagttccacctcctgcggcggaatcggcagggcgacgtcggcggcacgtgcggggtc
gtggacgacgagccccggccgactgggaaagcggagaccgaagacgaggacgaagggact
gagggcgaggacgaaggggctcagtggtcgccgcaggacccggcactgcaaggcgtagga
cagcccacaggaactggaagcataagaaagaagcgatttgtgtccagtcaccgctatgtg
gaaaccatgcttgtggcagaccagtcgatggcagaattccacggcagtggtctaaagcat
taccttctcacgttgttttcggtggcagccagattgtacaaacaccccagcattcgtaat
tcagttagcctggtggtggtgaagatcttggtcatccacgatgaacagaaggggccggaa
gtgacctccaatgctgccctcactctgcggaacttttgcaactggcagaagcagcacaac
ccacccagtgaccgggatgcagagcactatgacacagcaattcttttcaccagacaggac
ttgtgtgggtcccagacatgtgatactcttgggatggctgatgttggaactgtgtgtgat
ccgagcagaagctgctccgtcatagaagatgatggtttacaagctgccttcaccacagcc
catgaattaggccacgtgtttaacatgccacatgatgatgcaaagcagtgtgccagcctt
aatggtgtgaaccaggattcccacatgatggcgtcaatgctttccaacctggaccacagc
cagccttggtctccttgcagtgcctacatgattacatcatttctggataatggtcatggg
gaatgtttgatggacaagcctcagaatcccatacagctcccaggcgatctccctggcacc
tcgtacgatgccaaccggcagtgccagtttacatttggggaggactccaaacactgcccc
gatgcagccagcacatgtagcaccttgtggtgtaccggcacctctggtggggtgctggtg
tgtcaaaccaaacacttcccgtgggcggatggcaccagctgtggagaagggaaatggtgt
atcaacggcaagtgtgtgaacaaaaccgacagaaagcattttgatacgccttttcatgga
agctggggaatgtgggggccttggggagactgttcgagaacgtgcggtggaggagtccag
tacacgatgagggaatgtgacaacccagtcccaaagaatggagggaagtactgtgaaggc
aaacgagtgcgctacagatcctgtaaccttgaggactgtccagacaataatggaaaaacc
tttagagaggaacaatgtgaagcacacaacgagttttcaaaagcttcctttgggagtggg
cctgcggtggaatggattcccaagtacgctggcgtctcaccaaaggacaggtgcaagctc
atctgccaagccaaaggcattggctacttcttcgttttgcagcccaaggttgtagatggt
actccatgtagcccagattccacctctgtctgtgtgcaaggacagtgtgtaaaagctggt
tgtgatcgcatcatagactccaaaaagaagtttgataaatgtggtgtttgcgggggaaat
ggatctacttgtaaaaaaatatcaggatcagttactagtgcaaaacctggatatcatgat
atcatcacaattccaactggagccaccaacatcgaagtgaaacagcggaaccagagggga
tccaggaacaatggcagctttcttgccatcaaagctgctgatggcacatatattcttaat
ggtgactacactttgtccaccttagagcaagacattatgtacaaaggtgttgtcttgagg
tacagcggctcctctgcggcattggaaagaattcgcagctttagccctctcaaagagccc
ttgaccatccaggttcttactgtgggcaatgcccttcgacctaaaattaaatacacctac
ttcgtaaagaagaagaaggaatctttcaatgctatccccactttttcagcatgggtcatt
gaagagtggggcgaatgttctaagtcatgtgaattgggttggcagagaagactggtagaa
tgccgagacattaatggacagcctgcttccgagtgtgcaaaggaagtgaagccagccagc
accagaccttgtgcagaccatccctgcccccagtggcagctgggggagtggtcatcatgt
tctaagacctgtgggaagggttacaaaaaaagaagcttgaagtgtctgtcccatgatgga
ggggtgttatctcatgagagctgtgatcctttaaagaaacctaaacatttcatagacttt
tgcacaatggcagaatgcagttaa

DBGET integrated database retrieval system