KEGG   Homo sapiens (human): 9513Help
Entry
9513              CDS       T01001                                 

Gene name
FXR2, FMR1L2, FXR2P
Definition
(RefSeq) FMR1 autosomal homolog 2
  KO
K15516  fragile X mental retardation protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    9513 (FXR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9513 (FXR2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     9513 (FXR2)
   Factors involved in mRNA localization
    Other mRNA localization factors
     9513 (FXR2)
   mRNA cycle factors
    Stress granule specific factors
     9513 (FXR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FXMRP1_C_core FXR_C1 Tudor_FRX1 KH_9 KH_1 Agenet KH_2 NdhS
Motif
Other DBs
NCBI-GeneID: 9513
NCBI-ProteinID: NP_004851
OMIM: 605339
HGNC: 4024
Ensembl: ENSG00000129245
Vega: OTTHUMG00000178237
Pharos: P51116(Tbio)
UniProt: P51116
Structure
PDB: 

Position
17p13.1
AA seq 673 aa AA seqDB search
MGGLASGGDVEPGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLP
PPADYNKEITEGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNEIVTLE
RLRPVNPNPLATKGSFFKVTMAVPEDLREACSNENVHKEFKKALGANCIFLNITNSELFI
LSTTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLETSKQLAAAFQEEFTVREDLM
GLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSEDSVQVPR
NLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQAL
LEYHLSYLQEVEQLRLERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYSTDESSSSSLH
ATRTYGGSYGGRGRGRRTGGPAYGPSSDVSTASETESEKREEPNRAGPGDRDPPTRGEES
RRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDPDSNPYSLLDTSEPEPPVDSEPGEPPP
ASARRRRSRRRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDG
SISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLPKGPSENGELS
APLELGSMVNGVS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcctggcctctgggggggatgtggagccgggactgcccgtcgaggtgcgcggc
tccaacggggccttctacaagggctttgtgaaggatgtccatgaagactctgtcaccatc
ttctttgaaaacaactggcagagtgagagacaaattccttttggggatgtccggctacca
cctccagctgactataataaggagatcacagaaggggatgaagtggaggtttattctcga
gccaatgaacaggaaccttgtggctggtggctggcccgggtgcggatgatgaagggagat
ttctatgtcattgaatatgctgcctgtgatgccacctacaatgaaattgttaccctggag
cgacttcggccagttaatcccaatccccttgcaaccaaaggcagcttcttcaaggttacc
atggctgtgcccgaggatctgagagaagcctgctccaatgaaaacgtccataaagagttc
aagaaagccctgggagccaactgcatctttctcaacatcacaaacagtgagctcttcatt
ctgtcaaccacagaagcccctgtgaagcgagcatctctgctgggtgatatgcatttccga
agcctgcgcaccaaactgctacttatgtcccgcaatgaagaagctaccaagcacctagag
acaagcaagcagttggcagcagccttccaagaggagttcacagtgcgagaggacctgatg
ggactggcaattgggactcacggtgccaacatccagcaggcccgaaaagtacctggggtg
accgccattgagttgggtgaagagacctgcactttccgcatctatggggagactcccgag
gcttgccgacaggcccgaagctaccttgagttttctgaggactcagtgcaagtgcccagg
aacctggttggcaaagtgattggaaagaacgggaaagtgatccaggagattgtggataaa
tctggtgtggtgagggttcgagtggaaggtgataatgacaagaagaaccccagggaggag
ggaatggttcccttcatttttgttggcacccgagagaacatcagcaatgcccaggctttg
ctggagtatcacctctcctacctgcaggaggtagagcagcttcgcttggagaggctacaa
attgatgagcagcttcggcagattgggctgggctttcgccctcctgggagtgggcggggc
agcggtggcagcgacaaggctggatatagcactgatgagagctcctcctcctccctccat
gcgactcgaacctatgggggcagctatgggggccgtggccgtggccggaggacaggcggt
cctgcctatggccccagctcagatgtgtctacagcttcagagactgagtcagagaagaga
gaggagcccaaccgagctgggcctggcgacagggatcccccaacccgaggggaagaaagc
cggaggcggccgactgggggccggggtaggggacccccacctgccccccggcccacttcg
agatacaattcttcatctattagctcagtgctgaaggatccagacagtaatccctacagc
ctattggacacgtctgaaccagagcccccggttgattcagaacctggggaacccccccca
gcaagtgccaggcgccgccgctcccgccgccgccgcactgatgaagacaggaccgtcatg
gatggaggcctggaatcagatgggcccaacatgacagagaatggcctggaagatgaatca
agacctcaacgtcgtaatcgcagccgccgccgccgtaaccgtggtaatcggactgatggc
tctatcagtggagaccgccagccagtgactgtggctgactatatctcacgagcagagtct
cagagccgccagaggccacccctggaacgcactaaaccctcagaagactctctttcagga
cagaagggtgactctgtcagcaagcttcctaagggcccctcggagaatggggagctctcc
gcccccttggagttgggtagtatggtgaatggggtttcataa

DBGET integrated database retrieval system