KEGG   Homo sapiens (human): 9517Help
Entry
9517              CDS       T01001                                 

Gene name
SPTLC2, HSN1C, LCB2, LCB2A, NSAN1C, SPT2, hLCB2a
Definition
(RefSeq) serine palmitoyltransferase long chain base subunit 2
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Disease
H00265  Hereditary sensory and autonomic neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    9517 (SPTLC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    9517 (SPTLC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    9517 (SPTLC2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     9517 (SPTLC2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class II
   9517 (SPTLC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 9517
NCBI-ProteinID: NP_004854
OMIM: 605713
HGNC: 11278
Ensembl: ENSG00000100596
Vega: OTTHUMG00000171540
Pharos: O15270(Tchem)
UniProt: O15270 A0A024R6H1
Position
14q24.3
AA seq 562 aa AA seqDB search
MRPEPGGCCCRRTVRANGCVANGEVRNGYVRSSAAAAAAAAAGQIHHVTQNGGLYKRPFN
EAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFEN
FYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLG
FARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGMGFA
TNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQ
PRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVV
EYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQII
TSMKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIG
AFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYS
RHRLVPLLDRPFDETTYEETED
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcggccggagcccggaggctgctgctgccgccgcacggtgcgggcgaatggctgcgtg
gcgaacggggaagtacggaacgggtacgtgaggagcagcgctgcagccgcagccgcagcc
gccgccggccagatccatcatgttacacaaaatggaggactatataaaagaccgtttaat
gaagcttttgaagaaacaccaatgctggttgctgtgctcacgtatgtggggtatggcgta
ctcaccctctttggatatcttcgagatttcttgaggtattggagaattgaaaagtgtcac
catgcaacagaaagagaagaacaaaaggactttgtgtcattgtatcaagattttgaaaac
ttttatacaaggaatctgtacatgaggataagagacaactggaatcggccaatctgtagt
gtgcctggagccagggtggacatcatggagagacagtctcatgattataactggtccttc
aagtatacagggaatataataaagggtgttataaacatgggttcctacaactatcttgga
tttgcacggaatactggatcatgtcaagaagcagccgccaaagtccttgaggagtatgga
gctggagtgtgcagtactcggcaggaaattggaaacctggacaagcatgaagaactagag
gagcttgtagcaaggttcttaggagtagaagctgctatggcgtatggcatgggatttgca
acgaattcaatgaacattcctgctcttgttggcaaaggttgcctgattctgagtgatgaa
ctgaatcatgcatcactggttctgggagccagactgtcaggagcaaccattagaatcttc
aaacacaacaatatgcaaagcctagagaagctattgaaagatgccattgtttatggtcag
cctcggacacgaaggccctggaagaaaattctcatccttgtggaaggaatatatagcatg
gagggatctattgttcgtcttcctgaagtgattgccctcaagaagaaatacaaggcatac
ttgtatctggatgaggctcacagcattggcgccctgggccccacaggccggggtgtggtg
gagtactttggcctggatcccgaggatgtggatgttatgatgggaacgttcacaaagagt
tttggtgcttctggaggatatattggaggcaagaaggagctgatagactacctgcgaaca
cattctcatagtgcagtgtatgccacgtcattgtcacctcctgtagtggagcagatcatc
acctccatgaagtgcatcatggggcaggatggcaccagccttggtaaagagtgtgtacaa
cagttagctgaaaacaccaggtatttcaggagacgcctgaaagagatgggcttcatcatc
tatggaaatgaagactctccagtagtgcctttgatgctctacatgcctgccaaaattggc
gcctttggacgggagatgctgaagcggaacatcggtgtcgttgtggttggatttcctgcc
accccaattattgagtccagagccaggttttgcctgtcagcagctcataccaaagaaata
cttgatactgctttaaaggagatagatgaagttggggacctattgcagctgaagtattcc
cgtcatcggttggtacctctactggacaggccctttgacgagacgacgtatgaagaaaca
gaagactga

DBGET integrated database retrieval system