KEGG   Homo sapiens (human): 9520
Entry
9520              CDS       T01001                                 
Symbol
NPEPPS, AAP-S, MP100, PSA
Name
(RefSeq) aminopeptidase puromycin sensitive
  KO
K08776  puromycin-sensitive aminopeptidase [EC:3.4.11.14]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9520 (NPEPPS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.14  cytosol alanyl aminopeptidase
     9520 (NPEPPS)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M1
   9520 (NPEPPS)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF6263
Other DBs
NCBI-GeneID: 9520
NCBI-ProteinID: NP_006301
OMIM: 606793
HGNC: 7900
Ensembl: ENSG00000141279
UniProt: P55786
Position
17:47522933..47623276
AA seq 919 aa
MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSP
INYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGF
NYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFE
ATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPV
MSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPY
PLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFG
NLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE
VSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLWE
SLENASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGGSYVGEDCPQW
MVPITISTSEDPNQAKLKILMDKPEMNVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLES
LLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNLG
ILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHKA
TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIE
RVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN
RYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKR
DAESIHQYLLQRKASPPTV
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgtggctggcagctgccgccccctccctcgctcgccgcctgctcttcctcggccctccg
cctcctcccctcctccttctcgtcttcagccgctcctctcgccgccgcctccacagcctg
ggcctcgccgcgatgccggagaagaggcccttcgagcggctgcctgccgatgtctccccc
atcaactacagcctttgcctcaagcccgacttgctggacttcaccttcgagggcaagctg
gaggccgccgcccaggtgaggcaggcgactaatcagattgtgatgaattgtgctgatatt
gatattattacagcttcatatgcaccagaaggagatgaagaaatacatgctacaggattt
aactatcagaatgaagatgaaaaagtcaccttgtctttccctagtactctgcaaacaggt
acgggaaccttaaagatagattttgttggagagctgaatgacaaaatgaaaggtttctat
agaagtaaatatactaccccttctggagaggtgcgctatgctgctgtaacacagtttgag
gctactgatgcccgaagggcttttccttgctgggatgagcctgctatcaaagcaactttt
gatatctcattggttgttcctaaagacagagtagctttatcaaacatgaatgtaattgac
cggaaaccataccctgatgatgaaaatttagtggaagtgaagtttgcccgcacacctgtt
atgtctacatatctggtggcatttgttgtgggtgaatatgactttgtagaaacaaggtca
aaagatggtgtgtgtgtccgtgtttacactcctgttggcaaagcagagcaaggaaaattt
gcgttagaggttgctgctaaaaccttgcctttttataaggactacttcaatgttccttat
cctctacctaaaattgatctcattgctattgcagactttgcagctggtgccatggagaac
tggggccttgttacttatagggagactgcattgcttattgatccaaaaaattcctgttct
tcatcccgccagtgggttgctctggttgtgggacatgaactcgcccatcaatggtttgga
aatcttgttactatggaatggtggactcatctttggttaaatgaaggttttgcatcctgg
attgaatatctgtgtgtagaccactgcttcccagagtatgatatttggactcagtttgtt
tctgctgattacacccgtgcccaggagcttgacgccttagataacagccatcctattgaa
gtcagtgtgggccatccatctgaggttgatgagatatttgatgctatatcatatagcaaa
ggtgcatctgtcatccgaatgctgcatgactacattggggataaggactttaagaaagga
atgaacatgtatttaaccaagttccaacaaaagaatgctgccacagaggatctctgggaa
agtttagaaaatgctagtggtaaacctatagcagctgtgatgaatacctggaccaaacaa
atgggatttcccctcatttatgtggaagctgaacaggtagaagatgacagattattgagg
ttgtcccaaaagaagttctgtgctggtgggtcatatgttggtgaagattgtccccagtgg
atggtccctatcacaatctctactagtgaagaccccaaccaggccaaactaaaaattcta
atggacaagccagagatgaatgtggttttgaaaaatgtcaaaccagaccaatgggtgaag
ttaaacttaggaacagttgggttttatcggacccagtacagctctgccatgctggaaagt
ttattaccaggcattcgtgacctttctctgccccctgtggatcgacttggattacagaat
gacctcttctccttggctcgagctggaatcattagcactgtagaggttctaaaagtcatg
gaggcttttgtgaatgagcccaattatactgtatggagcgacctgagctgtaacctgggg
attctctcaactctcttgtcccacacagacttctatgaggaaatccaggagtttgtgaaa
gatgtcttttcacctataggggagagactgggctgggaccccaaacctggagaaggtcat
ctcgatgcactcctgaggggcttggttctgggaaaactaggaaaagcaggacataaggca
acgttagaagaagcccgtcgtcggtttaaggaccacgtggaaggaaaacagattctctcc
gctgatctgaggagtcctgtctatctgactgttttgaagcatggtgatggcactacttta
gatattatgttaaaacttcataaacaagcagatatgcaagaagagaaaaaccgaatcgaa
agagtccttggcgctactcttttgcctgacctgattcaaaaagtcctcacgtttgcactt
tcagaagaggtacgtccacaggacactgtatcggtaattggtggagtagctggaggcagc
aagcatggtaggaaagctgcttggaaattcataaaggacaactgggaagaactttataac
cgataccagggaggattcttaatatccagactaataaagctatcagttgagggatttgca
gttgataaaatggctggagaggttaaggctttcttcgagagtcacccagctccttcagct
gagcgtaccatccagcagtgttgtgaaaatattctgctgaatgctgcctggctaaagcga
gatgctgagagcatccaccagtacctccttcagcggaaggcctcaccacccacagtgtga

DBGET integrated database retrieval system