KEGG   Homo sapiens (human): 9527Help
Entry
9527              CDS       T01001                                 

Gene name
GOSR1, GOLIM2, GOS-28, GOS28, GOS28/P28, GS28, P28
Definition
(RefSeq) golgi SNAP receptor complex member 1
  KO
K08495  golgi SNAP receptor complex member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9527 (GOSR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9527 (GOSR1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[N] (Qb)
   Gos1 (Gos28)
    9527 (GOSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-SNARE_C Sec20 DUF1664
Motif
Other DBs
NCBI-GeneID: 9527
NCBI-ProteinID: NP_004862
OMIM: 604026
HGNC: 4430
Ensembl: ENSG00000108587
Vega: OTTHUMG00000132796
Pharos: O95249(Tbio)
UniProt: O95249
Position
17q11.2
AA seq 250 aa AA seqDB search
MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNG
SSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTH
EFHKTKANFMAIRERENLMGSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEET
ISIAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGIC
TILLLLYAFH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagggaccagcagttactgggaagatctcaggaaacaggctcgacagctggaa
aatgaacttgacctgaaactagtttccttcagcaaactatgtacaagttacagtcatagc
agtacccgagatggaagacgcgacaggtatagttctgatacaacaccccttttaaatgga
tcaagccaagacagaatgtttgagacaatggcgattgagattgaacaacttttggcaagg
cttacaggggtaaatgataaaatggcagaatataccaacagtgcaggtgtcccctccttg
aatgcagccctgatgcatacattacagcggcatagagacatattgcaggattatacacat
gaattccataaaaccaaagcaaactttatggcaatacgggaaagggagaatcttatggga
tcagtacgaaaagatattgagtcatataaaagtgggtctggagtaaacaacagaagaact
gagctatttttgaaagaacatgaccaccttcgaaactcagatcgtctgatagaagagaca
ataagcattgctatggcaacaaaagaaaatatgacttcacagagaggaatgttgaagtca
attcacagcaaaatgaacactttggccaatcgttttcctgctgtaaacagcctgatccag
aggatcaacctgaggaagcggcgggactcgctcatcctagggggtgttattgggatctgt
accatcctgttgctgctgtatgcgttccattga

DBGET integrated database retrieval system