KEGG   Homo sapiens (human): 9528Help
Entry
9528              CDS       T01001                                 

Gene name
TMEM59, C1orf8, DCF1, HSPC001, PRO195, UNQ169
Definition
(RefSeq) transmembrane protein 59
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: BSMAP
Motif
Other DBs
NCBI-GeneID: 9528
NCBI-ProteinID: NP_004863
OMIM: 617084
HGNC: 1239
Ensembl: ENSG00000116209
Vega: OTTHUMG00000008437
Pharos: Q9BXS4(Tbio)
UniProt: Q9BXS4
Position
1p32.3
AA seq 323 aa AA seqDB search
MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHT
YPKEEELYACQRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQ
LPFAELRQEQLMSLMPKMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIF
QSKPEIQYAPHLEQEPTNLRESSLSKMSYLQMRNSQAHRNFLEDGESDGFLRCLSLNSGW
ILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGDLEFMNEQKLNRYPASSLVVVR
SKTEDHEEAGPLPTKVNLAHSEI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgaaggggagcctctgggtgaggacccaactggggctcccgccgctgctg
ctgctgaccatggccttggccggaggttcggggaccgcttcggctgaagcatttgactcg
gtcttgggtgatacggcgtcttgccaccgggcctgtcagttgacctaccccttgcacacc
taccctaaggaagaggagttgtacgcatgtcagagaggttgcaggctgttttcaatttgt
cagtttgtggatgatggaattgacttaaatcgaactaaattggaatgtgaatctgcatgt
acagaagcatattcccaatctgatgagcaatatgcttgccatcttggttgccagaatcag
ctgccattcgctgaactgagacaagaacaacttatgtccctgatgccaaaaatgcaccta
ctctttcctctaactctggtgaggtcattctggagtgacatgatggactccgcacagagc
ttcataacctcttcatggactttttatcttcaagccgatgacggaaaaatagttatattc
cagtctaagccagaaatccagtacgcaccacatttggagcaggagcctacaaatttgaga
gaatcatctctaagcaaaatgtcctatctgcaaatgagaaattcacaagcgcacaggaat
tttcttgaagatggagaaagtgatggctttttaagatgcctctctcttaactctgggtgg
attttaactacaactcttgtcctctcggtgatggtattgctttggatttgttgtgcaact
gttgctacagctgtggagcagtatgttccctctgagaagctgagtatctatggtgacttg
gagtttatgaatgaacaaaagctaaacagatatccagcttcttctcttgtggttgttaga
tctaaaactgaagatcatgaagaagcagggcctctacctacaaaagtgaatcttgctcat
tctgaaatttaa

DBGET integrated database retrieval system