KEGG   Homo sapiens (human): 9529
Entry
9529              CDS       T01001                                 
Symbol
BAG5, BAG-5, CMD2F
Name
(RefSeq) BAG cochaperone 5
  KO
K09559  BCL2-associated athanogene 5
Organism
hsa  Homo sapiens (human)
Disease
H00294  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9529 (BAG5)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  BAG
   9529 (BAG5)
SSDB
Motif
Pfam: BAG ZW10_C2 RRF
Other DBs
NCBI-GeneID: 9529
NCBI-ProteinID: NP_001015048
OMIM: 603885
HGNC: 941
Ensembl: ENSG00000166170
UniProt: Q9UL15 A0A024R6M6
Structure
Position
14:complement(103556551..103562657)
AA seq 447 aa
MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEG
KGDIQQARKRAAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVT
DEFEEGIQDIILRLTHVKTGGKISLRKARYHTLTKICAVQEIIEDCMKKQPSLPLSEDAH
PSVAKINFVMCEVNKARGVLIALLMGVNNNETCRHLSCVLSGLIADLDALDVCGRTEIRN
YRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIEKVLKRMREIKNELLQAQNPS
ELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKEALEKRKLFAC
EEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC
KAARKQAVRLAQNILSYLDLKSDEWEY
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggatatgggaaaccaacatccttctattagtaggcttcaggaaatccaaaaggaagta
aaaagtgtagaacagcaagttatcggcttcagtggtctgtcagatgacaagaattacaag
aaactggagaggattctaacaaaacagctttttgaaatagactctgtagatactgaagga
aaaggagatattcagcaagctaggaagcgggcagcacaggagacagaacgtcttctcaaa
gagttggagcagaatgcaaaccacccacaccggattgaaatacagaacatttttgaggaa
gcccagtccctcgtgagagagaaaattgtgccattttataatggaggcaactgcgtaact
gatgagtttgaagaaggcatccaagatatcattctgaggctgacacatgttaaaactgga
ggaaaaatctccttgcggaaagcaaggtatcacactttaaccaaaatctgtgcggtgcaa
gagataatcgaagactgcatgaaaaagcagccttccctgccgctttccgaggatgcacat
ccttccgttgccaaaatcaacttcgtgatgtgtgaggtgaacaaggcccgaggggtcctg
attgcacttctgatgggtgtgaacaacaatgagacctgcaggcacttatcctgtgtgctc
tcggggctgatcgctgacctggatgctctagatgtgtgcggccggacagaaatcagaaat
tatcggagggaggtagtagaagatatcaacaaattattgaaatatctggatttggaagag
gaagcagacacaactaaagcatttgacctgagacagaatcattccattttaaaaatagaa
aaggtcctcaagagaatgagagaaataaaaaatgaacttctccaagcacaaaacccttct
gaattgtacctgagctccaaaacagaattgcagggtttaattggacagttggatgaggta
agtcttgaaaaaaacccctgcatccgggaagccaggagaagagcagtgatcgaggtgcaa
actctgatcacatatattgacttgaaggaggcccttgagaaaagaaagctgtttgcttgt
gaggagcacccatcccataaagccgtctggaacgtccttggaaacttgtctgagatccag
ggagaagttctttcatttgatggaaatcgaaccgataagaactacatccggctggaagag
ctgctcaccaagcagctgctagccctggatgctgttgatccgcagggagaagagaagtgt
aaggctgccaggaaacaagctgtgaggcttgcgcagaatattctcagctatctcgacctg
aaatctgatgaatgggagtactga

DBGET integrated database retrieval system