KEGG   Homo sapiens (human): 9532Help
Entry
9532              CDS       T01001                                 

Gene name
BAG2, BAG-2, dJ417I1.2
Definition
(RefSeq) BAG cochaperone 2
  KO
K09556  BCL2-associated athanogene 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9532 (BAG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9532 (BAG2)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  BAG
   9532 (BAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding_C_2 ParD_antitoxin NES_C_h
Motif
Other DBs
NCBI-GeneID: 9532
NCBI-ProteinID: NP_004273
OMIM: 603882
HGNC: 938
Ensembl: ENSG00000112208
Vega: OTTHUMG00000014919
Pharos: O95816(Tbio)
UniProt: O95816
Position
6p12.1
AA seq 211 aa AA seqDB search
MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEV
VNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENSDKAIKLLEHSKGAGSKTLQQNAESRFN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcgaagatcaacgctaaagccaacgaggggcgcttctgccgctcctcctcc
atggctgaccgctccagccgcctgctggagagcctggaccagctggagctcagggttgaa
gctttgagagaagcagcaactgctgttgagcaagagaaagaaatccttctggaaatgatc
cacagtatccaaaatagccaggacatgaggcagatcagtgacggagaaagagaagaatta
aatctgactgcaaaccgtttgatgggaagaactctcaccgttgaagtgtcagtagaaaca
attagaaacccccagcagcaagaatccctaaagcatgccacaaggattattgatgaggtg
gtcaataagtttctggatgatttgggaaatgccaagagtcatttaatgtcgctctacagt
gcatgttcatctgaggtgccacatgggccagttgatcagaagtttcaatccatagtaatt
ggctgtgctcttgaagatcagaagaaaattaagagaagattagagactctgcttagaaat
attgaaaactctgacaaggccatcaagctattagagcattctaaaggagctggttccaaa
actctgcaacaaaatgctgaaagcagattcaattag

DBGET integrated database retrieval system