KEGG   Homo sapiens (human): 9535Help
Entry
9535              CDS       T01001                                 

Gene name
GMFG, GMF-GAMMA
Definition
(RefSeq) glia maturation factor gamma
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Cofilin_ADF
Motif
Other DBs
NCBI-GeneID: 9535
NCBI-ProteinID: NP_004868
OMIM: 604104
HGNC: 4374
Ensembl: ENSG00000130755
Vega: OTTHUMG00000182811
Pharos: O60234(Tbio)
UniProt: O60234
Structure
PDB: 

Position
19q13.2
AA seq 142 aa AA seqDB search
MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKME
LPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKV
FEIRTTDDLTEAWLQEKLSFFR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactccctggtggtgtgcgaggtagacccagagctaacagaaaagctgaggaaa
ttccgcttccgaaaagagacagacaatgcagccatcataatgaaggtggacaaagaccgg
cagatggtggtgctggaggaagaatttcagaacatttccccagaggagctcaaaatggag
ttgccggagagacagcccaggttcgtggtttacagctacaagtacgtgcatgacgatggc
cgagtgtcctaccctttgtgtttcatcttctccagccctgtgggctgcaagccggaacaa
cagatgatgtatgcagggagtaaaaacaggctggtgcagacagcagagctcacaaaggtg
ttcgaaatccgcaccactgatgacctcactgaggcctggctccaagaaaagttgtctttc
tttcgttga

DBGET integrated database retrieval system