KEGG   Homo sapiens (human): 9536Help
Entry
9536              CDS       T01001                                 

Gene name
PTGES, MGST-IV, MGST1-L1, MGST1L1, MPGES, PGES, PIG12, PP102, PP1294, TP53I12, mPGES-1
Definition
(RefSeq) prostaglandin E synthase
  KO
K15729  microsomal prostaglandin-E synthase 1 [EC:5.3.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Drug target
Aceclofenac: D01545
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    9536 (PTGES)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     9536 (PTGES)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 9536
NCBI-ProteinID: NP_004869
OMIM: 605172
HGNC: 9599
Ensembl: ENSG00000148344
Vega: OTTHUMG00000020791
Pharos: O14684(Tchem)
UniProt: O14684
Structure
PDB: 

Position
9q34.11
AA seq 152 aa AA seqDB search
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccacagcctggtgatgagcagcccggccctcccggccttcctgctctgcagc
acgctgctggtcatcaagatgtacgtggtggccatcatcacgggccaagtgaggctgcgg
aagaaggcctttgccaaccccgaggatgccctgagacacggaggcccccagtattgcagg
agcgaccccgacgtggaacgctgcctcagggcccaccggaacgacatggagaccatctac
cccttccttttcctgggcttcgtctactcctttctgggtcctaacccttttgtcgcctgg
atgcacttcctggtcttcctcgtgggccgtgtggcacacaccgtggcctacctggggaag
ctgcgggcacccatccgctccgtgacctacaccctggcccagctcccctgcgcctccatg
gctctgcagatcctctgggaagcggcccgccacctgtga

DBGET integrated database retrieval system