KEGG   Homo sapiens (human): 9537
Entry
9537              CDS       T01001                                 
Symbol
TP53I11, PIG11
Name
(RefSeq) tumor protein p53 inducible protein 11
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: p53-inducible11 DUF4345
Other DBs
NCBI-GeneID: 9537
NCBI-ProteinID: NP_001245249
OMIM: 617867
HGNC: 16842
Ensembl: ENSG00000175274
Position
11:complement(44932348..44951306)
AA seq 189 aa
MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPL
GLRVWQFVSAVLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNA
LYTAEKVIIRWTLLTEACYFGVQFLVVTATLAETGLMSLGILLLLVSRLLFVVISIYYYY
QVGRRPKKA
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcggccaagcagcccccgcctctgatgaagaagcacagccagacggacctcgtgagc
cgcctgaagacccgcaagatcctcggcgtgggcggggaggatgacgacggggaggtgcat
cgctccaagatcagccaggtcttaggcaatgaaatcaagtttaccattcgggagcctttg
gggctcagggtctggcagttcgtctctgctgtgctcttctccggcattgccatcatggcg
cttgccttccctgaccagctctatgatgcggtctttgatggagcccaggtgaccagcaag
acccccatccgcctctacggcggtgccctcctcagcatctccctgatcatgtggaacgct
ctctacacggctgagaaggtcatcattcgatggaccctgctcaccgaagcttgctatttc
ggggtccagttcttggtggtcactgccacgctagctgagacgggcctcatgtccctgggg
atcctgctgctcctggtcagccgcctcctttttgtcgtcatcagcatttactactattac
caagtcggccgaagacccaagaaggcctag

DBGET integrated database retrieval system