KEGG   Homo sapiens (human): 9538
Entry
9538              CDS       T01001                                 

Gene name
EI24, EPG4, PIG8, TP53I8
Definition
(RefSeq) EI24 autophagy associated transmembrane protein
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    9538 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 9538
NCBI-ProteinID: NP_004870
OMIM: 605170
HGNC: 13276
Ensembl: ENSG00000149547
Vega: OTTHUMG00000165851
Pharos: O14681(Tbio)
UniProt: O14681 A0A024R3I8
Position
11q24.2
AA seq 340 aa
MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERK
QESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEF
FLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFL
SNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctgacagtgtcaaaacctttctccaggaccttgccagaggaatcaaagactccatc
tggggtatttgtaccatctcaaagctagatgctcgaatccagcaaaagagagaggagcag
cgtcgaagaagggcaagtagtgtcttggcacagagaagagcccagagtatagagcggaag
caagagagtgagccacgtattgttagtagaattttccagtgttgtgcttggaatggtgga
gtgttctggttcagtctcctcttgttttatcgagtatttattcctgtgcttcagtcggta
acagcccgaattatcggtgacccatcactacatggagatgtttggtcgtggctggaattc
ttcctcacgtcaattttcagtgctctttgggtgctccccttgtttgtgcttagcaaagtg
gtgaatgccatttggtttcaggatatagctgacctggcatttgaggtatcagggaggaag
cctcacccattccctagtgtcagcaaaataattgctgacatgctcttcaaccttttgctg
caggctcttttcctcattcagggaatgtttgtgagtctctttcccatccatcttgtcggt
cagctggttagtctcctgcatatgtcccttctctactcactgtactgctttgaatatcgt
tggttcaataaaggaattgaaatgcaccagcggttgtctaacatagaaaggaattggcct
tactactttgggtttggtttgcccttggcttttctcacagcaatgcagtcctcatatatt
atcagtggctgccttttctctatcctctttcctttattcattatcagcgccaatgaagca
aagacccctggcaaagcatatctcttccagttgcgcctcttctccttggtggtcttctta
agcaacagactcttccacaagacagtctacctgcagtcggccctgagcagctctacttct
gcagagaagttcccttcaccgcatccgtcgcctgccaaactgaaggctactgcaggtcac
tga

KEGG   Homo sapiens (human): 9540
Entry
9540              CDS       T01001                                 

Gene name
TP53I3, PIG3
Definition
(RefSeq) tumor protein p53 inducible protein 3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    9540 (TP53I3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     9540 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N HupF_HypC
Other DBs
NCBI-GeneID: 9540
NCBI-ProteinID: NP_004872
OMIM: 605171
HGNC: 19373
Ensembl: ENSG00000115129
Vega: OTTHUMG00000090817
Pharos: Q53FA7(Tbio)
UniProt: Q53FA7
Structure
PDB: 
2J8Z 2OBY

Position
2p23.3
AA seq 332 aa
MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNI
LGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAA
IPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQM
AEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGL
MGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPV
LDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
NT seq 999 nt   +upstreamnt  +downstreamnt
atgttagccgtgcactttgacaagccgggaggaccggaaaacctctacgtgaaggaggtg
gccaagccgagcccgggggagggtgaagtcctcctgaaggtggcggccagcgccctgaac
cgggcggacttaatgcagagacaaggccagtatgacccacctccaggagccagcaacatt
ttgggacttgaggcatctggacatgtggcagagctggggcctggctgccagggacactgg
aagatcggggacacagccatggctctgctccccggtgggggccaggctcagtacgtcact
gtccccgaagggctcctcatgcctatcccagagggattgaccctgacccaggctgcagcc
atcccagaggcctggctcaccgccttccagctgttacatcttgtgggaaatgttcaggct
ggagactatgtgctaatccatgcaggactgagtggtgtgggcacagctgctatccaactc
acccggatggctggagctattcctctggtcacagctggctcccagaagaagcttcaaatg
gcagaaaagcttggagcagctgctggattcaattacaaaaaagaggatttctctgaagca
acgctgaaattcaccaaaggtgctggagttaatcttattctagactgcataggcggatcc
tactgggagaagaacgtcaactgcctggctcttgatggtcgatgggttctctatggtctg
atgggaggaggtgacatcaatgggcccctgttttcaaagctactttttaagcgaggaagt
ctgatcaccagtttgctgaggtctagggacaataagtacaagcaaatgctggtgaatgct
ttcacggagcaaattctgcctcacttctccacggagggcccccaacgtctgctgccggtt
ctggacagaatctacccagtgaccgaaatccaggaggcccataagtacatggaggccaac
aagaacataggcaagatcgtcctggaactgccccagtga

DBGET integrated database retrieval system