KEGG   Homo sapiens (human): 954Help
Entry
954               CDS       T01001                                 

Gene name
ENTPD2, CD39L1, NTPDase-2
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2
  KO
K01509  adenosinetriphosphatase [EC:3.6.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    954 (ENTPD2)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    954 (ENTPD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     954 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 954
NCBI-ProteinID: NP_982293
OMIM: 602012
HGNC: 3364
Ensembl: ENSG00000054179
Vega: OTTHUMG00000020953
Pharos: Q9Y5L3(Tbio)
UniProt: Q9Y5L3
Position
9q34.3
AA seq 495 aa AA seqDB search
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLG
ATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENF
IKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSF
LCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVS
LSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMG
LPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAF
GGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALV
LLLRQVHSAKLPSTI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaggtgcggtcactgctgccgccgctgctgctggccgccgcgggcctcgcc
ggcctcctactgctgtgcgtccccacccgcgacgtccgggagccgcccgccctcaagtat
ggcatcgtcctggacgctggttcttcacacacgtccatgtttatctacaagtggccggca
gacaaggagaacgacacaggcattgtgggccagcacagctcctgtgatgttccaggtggg
ggcatctccagctatgcagacaacccttctggggccagccagagtcttgttggatgcctc
gaacaggcgcttcaggatgtgcccaaagagagacacgcgggcacacccctctacctggga
gccacagcgggtatgcgcctgctcaacctgaccaatccagaggcctcgaccagtgtgctc
atggcagtgactcacacactgacccagtacccctttgacttccggggtgcacgcatcctc
tcgggccaggaagagggggtgtttggctgggtgactgccaactacctgctggagaacttc
atcaagtacggctgggtgggccggtggttccggccacggaaggggacactgggggccatg
gacctggggggtgcctctacccagatcacttttgagacaaccagtccagctgaggacaga
gccagcgaggtccagctgcatctctacggccagcactaccgagtctacacccacagcttc
ctctgctatggccgtgaccaggtcctccagaggctgctggccagcgccctccagacccac
ggcttccacccctgctggccgaggggcttttccacccaagtgctgctcggggatgtgtac
cagtcaccatgcaccatggcccagcggccccagaacttcaacagcagtgccagggtcagc
ctgtcagggagcagtgacccccacctctgccgagatctggtttctgggctcttcagcttc
tcctcctgccccttctcccgatgctctttcaatggggtcttccagcccccagtggctggg
aactttgtggccttctctgccttcttctacactgtggactttttgcggacttcgatgggg
ctgcccgtggccaccctgcagcagctggaggcagccgcagtgaatgtctgcaaccagacc
tgggctcagctgcaagctcgggtgccagggcaacgggcccgcctggccgactactgcgcc
ggggccatgttcgtgcagcagctgctgagtcgcggctacggcttcgacgagcgcgccttc
ggcggcgtgatcttccagaagaaggccgcggacactgcagtgggctgggcgctcggctac
atgctgaacctgaccaacctgatccccgccgacccgccggggctgcgcaagggcacagac
ttcagctcctgggtcgtcctcctgctgctcttcgcctccgcgctcctggctgcgcttgtc
ctgctgctgcgtcaggtgcactccgccaagctgccaagcaccatttag

DBGET integrated database retrieval system