KEGG   Homo sapiens (human): 9541Help
Entry
9541              CDS       T01001                                 

Gene name
CIR1, CIR
Definition
(RefSeq) corepressor interacting with RBPJ, 1
  KO
K06066  CBF1 interacting corepressor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    9541 (CIR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cir_N
Motif
Other DBs
NCBI-GeneID: 9541
NCBI-ProteinID: NP_004873
OMIM: 605228
HGNC: 24217
Ensembl: ENSG00000138433
Vega: OTTHUMG00000132338
Pharos: Q86X95(Tdark)
UniProt: Q86X95
Position
2q31.1
AA seq 450 aa AA seqDB search
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMG
DERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFA
LKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKDR
KKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSESESNNKEKKIQRKKRKKNKCS
GHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSDKKSR
THKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRND
SRSHGTDLYRGEKMYREHPGGTHTKVTQRE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggggaaatccttcgccaacttcatgtgcaagaaagactttcatcctgcctccaaatcc
aatatcaaaaaagtatggatggcagaacagaaaatatcatatgataagaagaaacaagaa
gaattgatgcagcaatatcttaaagaacaagaatcatatgataatagattgcttatggga
gatgaacgtgtaaagaatggccttaatttcatgtatgaagccccaccaggagctaaaaaa
gaaaacaaagagaaagaagaaacagaaggagagaccgaatacaaatttgaatggcagaaa
ggagccccacgagaaaaatatgccaaagatgacatgaacatcagagatcagccctttggt
attcaggttcgaaatgtgaggtgcattaaatgtcacaaatggggtcatgtcaacacagat
cgagaatgtcctttgtttggtctttctggaatcaatgcaagttcggttcccactgatggc
tcagggccatcgatgcacccctcggagctaatagcggagatgagaaacagtgggtttgca
ctgaaacgaaatgtactggggagaaacttgaccgcaaatgatccatcacaggagtatgtt
gcaagtgagggtgaagaagatccagaagttgaatttttaaagtcactaacaaccaaacaa
aaacagaaacttctcaggaaattagatcgactggagaagaaaaaaaagaaaaaagataga
aaaaagaaaaagtttcagaagagcagaagtaaacacaaaaaacataagtcctcttcttcc
tcatcttcctcctcctcctcctcttcctctactgagacttcagaaagcagtagtgagagt
gagagtaacaataaagaaaaaaaaatacaaaggaagaaaagaaagaaaaacaagtgttca
gggcataacaacagtgattctgaagagaaggacaagtctaagaagagaaagcttcatgaa
gaactttctagcagtcaccataaccgggaaaaagccaaggaaaagcccaggttcttaaaa
cacgagagttctagggaggacagcaaatggagccattctgattctgacaaaaagtccaga
acccataaacatagcccagagaagagaggctctgaaagaaaggaggggagcagcagaagc
cacggcagggaggaaaggagccggagaagccggagcagaagtcctggtagttacaagcaa
agggagacaaggaaacgggcacagcgaaatcctggtgaagagcaaagcagaagaaatgac
agcagaagccatggcacagacttgtatagaggagaaaaaatgtacagagagcacccagga
ggtacacatactaaagtgacacaaagagaatga

DBGET integrated database retrieval system