KEGG   Homo sapiens (human): 9542Help
Entry
9542              CDS       T01001                                 

Gene name
NRG2, DON1, HRG2, NTAK
Definition
(RefSeq) neuregulin 2
  KO
K05456  neuregulin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    9542 (NRG2)
 09160 Human Diseases
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    9542 (NRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9542 (NRG2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   9542 (NRG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set C2-set_2 Ig_6 EGF
Motif
Other DBs
NCBI-GeneID: 9542
NCBI-ProteinID: NP_004874
OMIM: 603818
HGNC: 7998
Ensembl: ENSG00000158458
Vega: OTTHUMG00000129241
Pharos: O14511(Tbio)
UniProt: O14511
Position
5q31.2
AA seq 850 aa AA seqDB search
MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSSESGSSSRSSSNNSSISRPA
APPEPRPQQQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSV
QDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVI
SVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLK
KMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNK
VKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCY
YIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVG
IVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPA
TDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLS
SVGTSKCNSPACVEARARRAAAYNLEERRRATAPPYHDSVDSLRDSPHSERYVSALTTPA
RLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLRHPAPPGPGPGP
GPGPGPGADMQRSYDSYYYPAAGPGPRRGTCALGGSLGSLPASPFRIPEDDEYETTQECA
PPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASDDD
ADDADGALAAESTPFLGLRGAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPP
PRAKQDSAPL
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggtttgctgctcagcgctgccgccgccgccactggagaagggtcggtgcagc
agctacagcgacagcagcagcagcagcagcgagaggagcagcagcagcagcagcagcagc
agcgagagcggcagcagcagcaggagcagcagcaacaacagcagcatctctcgtcccgct
gcgcccccagagccgcggccgcagcaacagccgcagccccgcagccccgcagcccggaga
gccgccgcccgttcgcgagccgcagccgccggcggcatgaggcgcgacccggcccccggc
ttctccatgctgctcttcggtgtgtcgctcgcctgctactcgcccagcctcaagtcagtg
caggaccaggcgtacaaggcacccgtggtggtggagggcaaggtacaggggctggtccca
gccggcggctccagctccaacagcacccgagagccgcccgcctcgggtcgggtggcgttg
gtaaaggtgctggacaagtggccgctccggagcggggggctgcagcgcgagcaggtgatc
agcgtgggctcctgtgtgccgctcgaaaggaaccagcgctacatctttttcctggagccc
acggaacagcccttagtctttaagacggcctttgcccccctcgataccaacggcaaaaat
ctcaagaaagaggtgggcaagatcctgtgcactgactgcgccacccggcccaagttgaag
aagatgaagagccagacgggacaggtgggtgagaagcaatcgctgaagtgtgaggcagca
gccggtaatccccagccttcctaccgttggttcaaggatggcaaggagctcaaccgcagc
cgagacattcgcatcaaatatggcaacggcagaaagaactcacgactacagttcaacaag
gtgaaggtggaggacgctggggagtatgtctgcgaggccgagaacatcctggggaaggac
accgtccggggccggctttacgtcaacagcgtgagcaccaccctgtcatcctggtcgggg
cacgcccggaagtgcaacgagacagccaagtcctattgcgtcaatggaggcgtctgctac
tacatcgagggcatcaaccagctctcctgcaaatgtccaaatggattcttcggacagaga
tgtttggagaaactgcctttgcgattgtacatgccagatcctaagcaaaaagccgaggag
ctgtaccagaagagggtcctgaccatcacgggcatctgcgtggctctgctggtcgtgggc
atcgtctgtgtggtggcctactgcaagaccaaaaaacagcggaagcagatgcacaaccac
ctccggcagaacatgtgcccggcccatcagaaccggagcttggccaatgggcccagccac
ccccggctggacccagaggagatccagatggcagattatatttccaagaacgtgccagcc
acagaccatgtcatcaggagagaaactgagaccaccttctctgggagccactcctgttct
ccttctcaccactgctccacagccacacccacctccagccacagacacgagagccacacg
tggagcctggaacgttctgagagcctgacttctgactcccagtcggggatcatgctatca
tcagtgggtaccagcaaatgcaacagcccagcatgtgtggaggcccgggcaaggcgggca
gcagcctacaacctggaggagcggcgcagggccaccgcgccaccctatcacgattccgtg
gactcccttcgcgactccccacacagcgagaggtacgtgtcggccctgaccacgcccgcg
cgcctctcgcccgtggacttccactactcgctggccacgcaggtgccaactttcgagatc
acgtcccccaactcggcgcacgccgtgtcgctgccgccggcggcgcccatcagttaccgc
ctggccgagcagcagccgttactgcggcacccggcgccccccggcccgggacccggaccc
gggcccgggcccgggcccggcgcagacatgcagcgcagctatgacagctactattacccc
gcggcggggcccggaccgcggcgcgggacctgcgcgctcggcggcagcctgggcagcctg
cctgccagccccttccgcatccccgaggacgacgagtacgagaccacgcaggagtgcgcg
cccccgccgccgccgcggccgcgcgcgcgcggtgcgtcccgcaggacgtcggcggggccc
cggcgctggcgccgctcgcgcctcaacgggctggcggcgcagcgcgcacgggcggcgagg
gactcgctgtcgctgagcagcggctcgggcggcggctcagcctcggcgtcggacgacgac
gcggacgacgcggacggggcgctggcggccgagagcacacctttcctgggcctgcgtggg
gcgcacgacgcgctgcgctcggactcgccgccactgtgcccggcggccgacagcaggact
tactactcactggacagccacagcacgcgggccagcagcagacacagccgcgggccgccc
ccgcgggccaagcaggactcggcgccactctag

DBGET integrated database retrieval system