KEGG   Homo sapiens (human): 9546
Entry
9546              CDS       T01001                                 
Symbol
APBA3, MGC:15815, X11L2, mint3
Name
(RefSeq) amyloid beta precursor protein binding family A member 3
  KO
K24035  amyloid beta A4 precursor protein-binding family A member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9546 (APBA3)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  Other PTB domain-containing proteins
   9546 (APBA3)
SSDB
Motif
Pfam: PID PDZ PDZ_6 PDZ_2 NRho
Other DBs
NCBI-GeneID: 9546
NCBI-ProteinID: NP_004877
OMIM: 604262
HGNC: 580
Ensembl: ENSG00000011132
Pharos: O96018(Tbio)
UniProt: O96018
Structure
Position
19:complement(3750772..3761692)
AA seq 575 aa
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQEL
VQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEE
CPPSQTGPEEPLEPAPRLLQPPEDPDEDSDSPEWVEGASAEQEGSRSSSSSPEPWLETVP
LVTPEEPPAGAQSPETLASYPAPQEVPGPCDHEDLLDGVIFGARYLGSTQLVSERNPPTS
TRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRIKVLTADSQEAMMDHALHTISYTADI
GCVLVLMARRRLARRPAPQDHGRRLYKMLCHVFYAEDAQLIAQAIGQAFAAAYSQFLRES
GIDPSQVGVHPSPGACHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVESGWGSLLPT
AVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVRETKSQTSVTLSIVHC
PPVTTAIIHRPHAREQLGFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQSVVATPHA
RIIELLTEAYGEVHIKTMPAATYRLLTGQEQPVYL
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggacttccccacaatttcccgatccccttcggggcctccagccatggacttggagggg
cccagggacattcttgtgccttcggaggacctcacccctgacagccagtgggaccctatg
ccaggaggccccggcagcctcagtcggatggaacttgatgagtcaagccttcaggagctg
gtgcagcagtttgaagctctgccaggcgatctggtgggcccatccccaggtggagccccc
tgtcccctacacattgccacaggccatggcctggcctcccaggagattgctgatgcccac
gggctcctgtctgccgaagctggccgggatgacctgctgggcctcttgcactgcgaggaa
tgcccgccttcccagactggtcctgaagagcctctagagcctgccccccgactgttgcag
ccccctgaggacccagatgaggattctgactccccagaatgggtggagggggcctctgct
gagcaggagggcagcaggagctcaagcagttccccggaaccctggctggagacggtgcct
ctagtcacacctgaagagccacccgctggtgcccagagccccgagaccctggcttcctac
cctgccccccaggaggtgcctggtccctgtgaccatgaagacctcctggacggtgtcata
tttggggccaggtacctggggtccacccagctggtgtcggaacggaacccgcccaccagc
acgcgcatggcccaggcccgggaggccatggaccgcgtcaaggcccccgatggggagacc
cagcccatgacggaggtggacctgttcgtctccaccaagaggatcaaggtcttgacagcg
gactcccaggaggccatgatggaccacgccctgcataccatctcctacacagccgacatc
ggctgcgtgctggtgctgatggcgcggcggcggctggcacggaggccggcaccccaggac
cacggccgccgcctctacaagatgctctgccacgtattctacgcggaggacgcccagctc
atcgcccaggccattggccaggccttcgccgccgcctacagccagttcctacgggaaagc
ggtattgaccccagccaggtgggcgtgcacccgagcccaggcgcctgccacctccataat
ggggacctggaccacttctccaacagtgacaactgccgggaggtgcacctcgagaagcgg
cgaggggagggcctgggcgtggccctggtggagtcgggctggggctccctgctgcccaca
gccgtcatcgccaacctgctgcacggggggcctgctgagcgctcgggggccctcagcatc
ggggaccgcctgaccgccatcaacgggaccagcctggtggggctgcccctggctgcgtgc
caggccgctgtccgcgagacgaagtcgcagacgtcggtgacactcagcatcgtccactgc
cctcccgtcaccaccgccatcatccaccggccccacgcccgcgagcagctgggcttctgc
gtggaggacggcatcatctgcagcctcctccgtggtggcatcgccgagcgtgggggcatc
cgcgtcggccaccgcatcattgagatcaatgggcagagtgtggtggccacgccacacgcc
cgcatcatcgagctgctcaccgaggcctatggcgaggtgcatatcaagacgatgccagct
gccacatatcgcctccttacaggccaggagcagcccgtgtacctgtga

DBGET integrated database retrieval system