KEGG   Homo sapiens (human): 9546Help
Entry
9546              CDS       T01001                                 

Gene name
APBA3, MGC:15815, X11L2, mint3
Definition
(RefSeq) amyloid beta precursor protein binding family A member 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PID PDZ PDZ_6 PDZ_2 NRho
Motif
Other DBs
NCBI-GeneID: 9546
NCBI-ProteinID: NP_004877
OMIM: 604262
HGNC: 580
Ensembl: ENSG00000011132
Vega: OTTHUMG00000180915
Pharos: O96018(Tbio)
UniProt: O96018
Structure
PDB: 

Position
19p13.3
AA seq 575 aa AA seqDB search
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQEL
VQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEE
CPPSQTGPEEPLEPAPRLLQPPEDPDEDSDSPEWVEGASAEQEGSRSSSSSPEPWLETVP
LVTPEEPPAGAQSPETLASYPAPQEVPGPCDHEDLLDGVIFGARYLGSTQLVSERNPPTS
TRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRIKVLTADSQEAMMDHALHTISYTADI
GCVLVLMARRRLARRPAPQDHGRRLYKMLCHVFYAEDAQLIAQAIGQAFAAAYSQFLRES
GIDPSQVGVHPSPGACHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVESGWGSLLPT
AVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVRETKSQTSVTLSIVHC
PPVTTAIIHRPHAREQLGFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQSVVATPHA
RIIELLTEAYGEVHIKTMPAATYRLLTGQEQPVYL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggacttccccacaatttcccgatccccttcggggcctccagccatggacttggagggg
cccagggacattcttgtgccttcggaggacctcacccctgacagccagtgggaccctatg
ccaggaggccccggcagcctcagtcggatggaacttgatgagtcaagccttcaggagctg
gtgcagcagtttgaagctctgccaggcgatctggtgggcccatccccaggtggagccccc
tgtcccctacacattgccacaggccatggcctggcctcccaggagattgctgatgcccac
gggctcctgtctgccgaagctggccgggatgacctgctgggcctcttgcactgcgaggaa
tgcccgccttcccagactggtcctgaagagcctctagagcctgccccccgactgttgcag
ccccctgaggacccagatgaggattctgactccccagaatgggtggagggggcctctgct
gagcaggagggcagcaggagctcaagcagttccccggaaccctggctggagacggtgcct
ctagtcacacctgaagagccacccgctggtgcccagagccccgagaccctggcttcctac
cctgccccccaggaggtgcctggtccctgtgaccatgaagacctcctggacggtgtcata
tttggggccaggtacctggggtccacccagctggtgtcggaacggaacccgcccaccagc
acgcgcatggcccaggcccgggaggccatggaccgcgtcaaggcccccgatggggagacc
cagcccatgacggaggtggacctgttcgtctccaccaagaggatcaaggtcttgacagcg
gactcccaggaggccatgatggaccacgccctgcataccatctcctacacagccgacatc
ggctgcgtgctggtgctgatggcgcggcggcggctggcacggaggccggcaccccaggac
cacggccgccgcctctacaagatgctctgccacgtattctacgcggaggacgcccagctc
atcgcccaggccattggccaggccttcgccgccgcctacagccagttcctacgggaaagc
ggtattgaccccagccaggtgggcgtgcacccgagcccaggcgcctgccacctccataat
ggggacctggaccacttctccaacagtgacaactgccgggaggtgcacctcgagaagcgg
cgaggggagggcctgggcgtggccctggtggagtcgggctggggctccctgctgcccaca
gccgtcatcgccaacctgctgcacggggggcctgctgagcgctcgggggccctcagcatc
ggggaccgcctgaccgccatcaacgggaccagcctggtggggctgcccctggctgcgtgc
caggccgctgtccgcgagacgaagtcgcagacgtcggtgacactcagcatcgtccactgc
cctcccgtcaccaccgccatcatccaccggccccacgcccgcgagcagctgggcttctgc
gtggaggacggcatcatctgcagcctcctccgtggtggcatcgccgagcgtgggggcatc
cgcgtcggccaccgcatcattgagatcaatgggcagagtgtggtggccacgccacacgcc
cgcatcatcgagctgctcaccgaggcctatggcgaggtgcatatcaagacgatgccagct
gccacatatcgcctccttacaggccaggagcagcccgtgtacctgtga

DBGET integrated database retrieval system