KEGG   Homo sapiens (human): 9547Help
Entry
9547              CDS       T01001                                 

Gene name
CXCL14, BMAC, BRAK, KEC, KS1, MIP-2g, MIP2G, NJAC, SCYB14
Definition
(RefSeq) C-X-C motif chemokine ligand 14
  KO
K10033  C-X-C motif chemokine 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9547 (CXCL14)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    9547 (CXCL14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   9547 (CXCL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 9547
NCBI-ProteinID: NP_004878
OMIM: 604186
HGNC: 10640
Ensembl: ENSG00000145824
Vega: OTTHUMG00000129139
Pharos: O95715(Tbio)
UniProt: O95715
Structure
PDB: 

Position
5q31.1
AA seq 111 aa AA seqDB search
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgctcccacgccgcgcccctccggtcagcatgaggctcctggcggccgcgctg
ctcctgctgctgctggcgctgtacaccgcgcgtgtggacgggtccaaatgcaagtgctcc
cggaagggacccaagatccgctacagcgacgtgaagaagctggaaatgaagccaaagtac
ccgcactgcgaggagaagatggttatcatcaccaccaagagcgtgtccaggtaccgaggt
caggagcactgcctgcaccccaagctgcagagcaccaagcgcttcatcaagtggtacaac
gcctggaacgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system