KEGG   Homo sapiens (human): 9551Help
Entry
9551              CDS       T01001                                 

Gene name
ATP5MF, ATP5J2, ATP5JL
Definition
(RefSeq) ATP synthase membrane subunit f
  KO
K02130  F-type H+-transporting ATPase subunit f
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    9551 (ATP5MF)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    9551 (ATP5MF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WRW F1F0-ATPsyn_F
Motif
Other DBs
NCBI-GeneID: 9551
NCBI-ProteinID: NP_004880
HGNC: 848
Ensembl: ENSG00000241468
Vega: OTTHUMG00000154609
Pharos: P56134(Tbio)
UniProt: P56134
Position
7q22.1
AA seq 94 aa AA seqDB search
MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKK
GSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagttggtgagtgtccggccccagtaccagtgaaggacaagaaacttctggag
gtcaaactgggggagctgccaagctggatcttgatgcgggacttcagtcctagtggcatt
ttcggagcgtttcaaagaggttactaccggtactacaacaagtacatcaatgtgaagaag
gggagcatctcggggattaccatggtgctggcatgctacgtgctctttagctactccttt
tcctacaagcatctcaagcacgagcggctccgcaaataccactga

DBGET integrated database retrieval system