KEGG   Homo sapiens (human): 9555Help
Entry
9555              CDS       T01001                                 

Gene name
H2AFY, H2A.y, H2A/y, H2AF12M, MACROH2A1.1, mH2A1, macroH2A1.2
Definition
(RefSeq) H2A histone family member Y
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    9555 (H2AFY)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    9555 (H2AFY)
  09165 Substance dependence
   05034 Alcoholism
    9555 (H2AFY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9555 (H2AFY)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9555 (H2AFY)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    9555 (H2AFY)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9555 (H2AFY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro Histone_H2A_C Histone CBFD_NFYB_HMF DUF1764 Clp_N
Motif
Other DBs
NCBI-GeneID: 9555
NCBI-ProteinID: NP_613258
OMIM: 610054
HGNC: 4740
Ensembl: ENSG00000113648
Vega: OTTHUMG00000129141
Pharos: O75367(Tbio)
UniProt: O75367
Structure
PDB: 

Position
5q31.1
AA seq 372 aa AA seqDB search
MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEI
LELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS
KGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPA
DGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKE
FVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL
ADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIG
IYVQEMAKLDAN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccgcggtgggaagaagaagtccaccaagacgtccaggtctgccaaagcagga
gtcatctttcccgtggggcggatgctgcggtacatcaagaaaggccaccccaagtacagg
attggagtgggggcacccgtgtacatggccgccgtcctggaatacctgacagcggagatt
ctggagctggctggcaatgcagcgagagacaacaagaagggacgggtcacaccccggcac
atcctgctggctgtggccaatgatgaagagctgaatcagctgctaaaaggagtcaccata
gccagtgggggtgtgttacccaacatccaccccgagttgctagcgaagaagcggggatcc
aaaggaaagttggaagccatcatcacaccacccccagccaaaaaggccaagtctccatcc
cagaagaagcctgtatctaaaaaagcaggaggcaagaaaggggcccggaaatccaagaag
aagcagggtgaagtcagtaaggcagccagcgccgacagcacaaccgagggcacacctgcc
gacggcttcacagtcctctccaccaagagcctcttccttggccagaagctgaaccttatt
cacagtgaaatcagtaatttagccggctttgaggtggaggccataatcaatcctaccaat
gctgacattgaccttaaagatgacctaggaaacacgctggagaagaaaggtggcaaggag
tttgtggaagctgtcctggaactccggaaaaagaacgggcccttggaagtagctggagct
gctgtcagcgcaggccatggcctgcctgccaagtttgtgatccactgtaatagtccagtt
tggggtgcagacaagtgtgaagaacttctggaaaagacagtgaaaaactgcttggccctg
gctgatgataagaagctgaaatccattgcatttccatccatcggcagcggcaggaacggt
tttccaaagcagacagcagctcagctgattctgaaggccatctccagttacttcgtgtct
acaatgtcctcttccatcaaaacggtgtacttcgtgctttttgacagcgagagtataggc
atctatgtgcaggaaatggccaagctggacgccaactag

DBGET integrated database retrieval system