KEGG   Homo sapiens (human): 9557Help
Entry
9557              CDS       T01001                                 

Gene name
CHD1L, ALC1, CHDL
Definition
(RefSeq) chromodomain helicase DNA binding protein 1 like
  KO
K20092  chromodomain-helicase-DNA-binding protein 1-like [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9557 (CHD1L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     9557 (CHD1L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    9557 (CHD1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII HDA2-3 DEAD AAA_22 Torsin ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 9557
NCBI-ProteinID: NP_004275
OMIM: 613039
HGNC: 1916
Ensembl: ENSG00000131778
Vega: OTTHUMG00000150271
Pharos: Q86WJ1(Tbio)
UniProt: Q86WJ1
Position
1q21.1
AA seq 897 aa AA seqDB search
MERAGATSRGGQAPGFLLRLHTEGRAEAARVQEQDLRQWGLTGIHLRSYQLEGVNWLAQR
FHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPG
LSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLK
NQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDI
EKESESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDA
FENETAKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLY
SGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQQPIFVFLLS
TRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVY
RKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGSTMDEIDLES
ILGETKDGQWVSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQK
TLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEE
KKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYV
SGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGV
LLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHL
PRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHSQSSSSSSRQLVP
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgggcgctactagccgcgggggccaagcccctggcttcttactgcggctt
catactgagggccgagccgaggcggcgcgggtgcaggagcaggacttacggcagtggggg
ctgacagggattcacctacgctcttaccagctggagggagtaaactggctcgcccagcgc
ttccattgtcagaatggctgtatcctgggagatgagatgggcctggggaagacctgccag
actattgctctcttcatttatttggcaggaagattaaatgatgaagggccatttctgatt
ctttgtcccttgtctgttttgagcaactggaaagaagaaatgcagagatttgctccaggt
ctttcctgtgtaacatatgcaggcgacaaggaggaaagagcctgccttcagcaagacctg
aaacaggagtcacgttttcatgtgctactgactacctatgagatttgcttgaaagatgca
tcatttctaaaatcattcccttggagtgttcttgttgtggatgaagctcacaggttgaaa
aaccaaagctccctgctgcataagaccttgtcagagttctcagtagtcttcagtctcctg
ttgaccggaactcccatccagaacagcctccaagagctctactccctcctcagttttgtg
gagcctgatctcttttccaaggaagaggtgggagattttattcaacgctaccaggatatt
gagaaagaatctgagtcagcaagtgaactgcacaaactcttgcagccatttctgctgagg
cgagtgaaagctgaggtagctacagagcttcccaagaagacagaagtagtgatataccat
ggcatgtcagcattgcagaagaaatactacaaggccattttgatgaaagacctagatgca
tttgaaaatgagacggcaaagaaagttaaactacagaacattttgtcccagcttcgaaag
tgtgtggatcacccatatttgtttgatggtgtggagccggagccttttgaagttggagac
cacctgactgaggctagtgggaagcttcacctgctggataagctactagcattcctgtat
tctgggggccatcgggttttacttttctcccaaatgacccagatgttggatattctccaa
gactatatggattacagaggctacagctatgagcgtgtggatggttctgtgagaggagaa
gagagacacttggccattaagaactttggacagcagcccattttcgtttttctcctgagt
actagggcaggtggagttggcatgaacttaacagcagcagatactgtgatttttgttgac
agtgactttaatcctcagaatgacttgcaagcagctgccagggctcatcgcattggccaa
aacaagtctgttaaagttattcggctgattggtcgagacactgtggaagaaatagtctat
aggaaagcagcctccaaactgcagctcaccaacatgatcatagaaggaggccattttact
ctgggagcccagaaacccgctgccgatgctgacctccagttgagtgagatactcaaattt
ggtttggataaactgctggcctctgaggggagcaccatggatgaaatagacctggagtcc
atcctgggagaaacaaaagatggccagtgggtctctgatgccttgcctgcagcagaagga
gggagcagagatcaagaggaaggaaaaaatcatatgtacttatttgaaggtaaagattat
tctaaagagcccagtaaggaagacagaaaatcatttgaacaactggtaaaccttcagaaa
acccttttggagaaagctagtcaagagggccgatcactccgaaataaaggcagtgttctc
atcccaggccttgtggagggatctaccaaaaggaagcgggttctgagtccagaagagctg
gaggacagacagaagaaaagacaagaagcagctgccaagagaaggagactcatagaggag
aagaagaggcaaaaggaagaggctgaacataagaaaaagatggcctggtgggaatccaac
aattaccagtccttctgcctgccctctgaggagagcgagccagaggaccttgagaatggg
gaagagagctctgctgagctggattaccaagacccagatgctacttccctcaagtacgtt
agtggtgatgtcacccaccctcaggctggggccgaggatgctctcattgtgcactgcgta
gatgactctggccactggggcagaggtggtttatttacagctctggaaaagcgatccgct
gagccaagaaaaatatatgagctggctgggaaaatgaaagacctgagtttgggaggtgtc
cttttatttcctgttgatgataaagaatcaagaaacaaagggcaagatttgttggccttg
attgtggctcagcatcgtgatcgttccaatgtcctgtctggcattaagatggcagcccta
gaagagggcctgaagaagatatttttagcagcaaaaaagaagaaagcaagtgttcatctt
ccacgtattggacatgccacgaaaggttttaactggtatggtactgagcgacttattcgg
aaacatctggctgcaagaggcatcccaacttacatatattattttcctagaagcaagtct
gctgtccttcattcacagtcttcatcttcctcctcaagacagctggtgccttaa

DBGET integrated database retrieval system