KEGG   Homo sapiens (human): 9559Help
Entry
9559              CDS       T01001                                 

Gene name
VPS26A, HB58, Hbeta58, PEP8A, VPS26
Definition
(RefSeq) VPS26, retromer complex component A
  KO
K18466  vacuolar protein sorting-associated protein 26
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9559 (VPS26A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9559 (VPS26A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    9559 (VPS26A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vps26 Arrestin_C Arrestin_N
Motif
Other DBs
NCBI-GeneID: 9559
NCBI-ProteinID: NP_004887
OMIM: 605506
HGNC: 12711
Ensembl: ENSG00000122958
Vega: OTTHUMG00000018376
Pharos: O75436(Tbio)
UniProt: O75436
Structure
PDB: 

Position
10q22.1
AA seq 327 aa AA seqDB search
MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAP
VKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPE
KLRKQRTNFHQRFESPESQASAEQPEM
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcttggaggcttttttggtccaatttgtgagatcgatattgttcttaatgat
ggggaaaccaggaaaatggcagaaatgaaaactgaagatggcaaagtagaaaaacactat
ctcttctatgacggagaatccgtttcaggaaaggtaaacctagcctttaagcaacctgga
aagaggctagaacaccaaggaattagaattgaatttgtaggtcaaattgaacttttcaat
gacaagagtaatactcatgaatttgtaaacctagtgaaagaactagccttacctggagaa
ctgactcagagcagaagttatgattttgaatttatgcaagttgaaaagccatatgaatct
tacatcggtgccaatgtccgcttgaggtattttcttaaagtgacaatagtgagaagactg
acagatttggtaaaagagtatgatcttattgttcaccagcttgccacctatcctgatgtt
aacaactctattaagatggaagtgggcattgaagattgtctacatatagaatttgaatat
aataaatcaaagtatcatttaaaggatgtgattgttggaaaaatttacttcttattagta
agaataaaaatacaacatatggagttacagctgatcaaaaaagagatcacaggaattgga
cccagtaccacaacagaaacagaaacaatcgccaaatatgaaataatggatggtgcacca
gtaaaaggtgaatcaattccaataaggctatttttagcaggatatgacccaactccaaca
atgagagatgtgaacaaaaaattttcagtaaggtactttttgaatttagtgcttgttgat
gaggaagaccggaggtacttcaaacagcaggagataattttatggagaaaagctcctgaa
aaactgaggaaacagagaacaaactttcaccagcgatttgaatctccagaatcacaggca
tctgccgaacagcctgaaatgtga

DBGET integrated database retrieval system