KEGG   Homo sapiens (human): 956Help
Entry
956               CDS       T01001                                 

Gene name
ENTPD3, CD39L3, HB6, NTPDase-3
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 3
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    956 (ENTPD3)
   00240 Pyrimidine metabolism
    956 (ENTPD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    956 (ENTPD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    956 (ENTPD3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     956 (ENTPD3)
CD molecules [BR:hsa04090]
 Proteins
  956 (ENTPD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39 DUF3739
Motif
Other DBs
NCBI-GeneID: 956
NCBI-ProteinID: NP_001239
OMIM: 603161
HGNC: 3365
Ensembl: ENSG00000168032
Vega: OTTHUMG00000131390
Pharos: O75355(Tbio)
UniProt: O75355
Position
3p22.1
AA seq 529 aa AA seqDB search
MFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIV
LDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKV
KGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQ
EEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTS
DIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTM
GHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQ
PKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARS
YCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRL
PIEPPVFVGTLAFFTAAALLCLAFLAYLCSATRRKRHSEHAFDHAVDSD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttcactgtgctgacccgccaaccatgtgagcaagcaggcctcaaggccctctaccga
actccaaccatcattgccttggtggtcttgcttgtgagtattgtggtacttgtgagtatc
actgtcatccagatccacaagcaagaggtcctccctccaggactgaagtatggtattgtg
ctggatgccgggtcttcaagaaccacagtctacgtgtatcaatggccagcagaaaaagag
aataataccggagtggtcagtcaaaccttcaaatgtagtgtgaaaggctctggaatctcc
agctatggaaataacccccaagatgtccccagagcctttgaggagtgtatgcaaaaagtc
aaggggcaggttccatcccacctccacggatccacccccattcacctgggagccacggct
gggatgcgcttgctgaggttgcaaaatgaaacagcagctaatgaagtccttgaaagcatc
caaagctacttcaagtcccagccctttgactttaggggtgctcaaatcatttctgggcaa
gaagaaggggtatatggatggattacagccaactatttaatgggaaatttcctggagaag
aacctgtggcacatgtgggtgcacccgcatggagtggaaaccacgggtgccctggactta
ggtggtgcctccacccaaatatccttcgtggcaggagagaagatggatctgaacaccagc
gacatcatgcaggtgtccctgtatggctacgtatacacgctctacacacacagcttccag
tgctatggccggaatgaggctgagaagaagtttctggcaatgctcctgcagaattctcct
accaaaaaccatctcaccaatccctgttaccctcgggattatagcatcagcttcaccatg
ggccatgtatttgatagcctgtgcactgtggaccagaggccagaaagttataaccccaat
gatgtcatcacttttgaaggaactggggacccatctctgtgtaaggagaaggtggcttcc
atatttgacttcaaagcttgccatgatcaagaaacctgttcttttgatggggtttatcag
ccaaagattaaagggccatttgtggcttttgcaggattctactacacagccagtgcttta
aatctttcaggtagcttttccctggacaccttcaactccagcacctggaatttctgctca
cagaattggagtcagctcccactgctgctccccaaatttgatgaggtatatgcccgctct
tactgcttctcagccaactacatctaccacttgtttgtgaacggttacaaattcacagag
gagacttggccccaaatacactttgaaaaagaagtggggaatagcagcatagcctggtct
cttggctacatgctcagcctgaccaaccagatcccagctgaaagccctctgatccgtctg
cccatagaaccacctgtctttgtgggcaccctcgctttcttcacagcggcagccttgctg
tgtctggcatttcttgcatacctgtgttcagcaaccagaagaaagaggcactccgagcat
gcctttgaccatgcagtggattctgactga

DBGET integrated database retrieval system