KEGG   Homo sapiens (human): 9560Help
Entry
9560              CDS       T01001                                 

Gene name
CCL4L2, AT744.2, CCL4L, SCYA4L, SCYQ4L2
Definition
(RefSeq) C-C motif chemokine ligand 4 like 2
  KO
K12964  C-C motif chemokine 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    9560 (CCL4L2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9560 (CCL4L2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    9560 (CCL4L2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    9560 (CCL4L2)
   04623 Cytosolic DNA-sensing pathway
    9560 (CCL4L2)
   04062 Chemokine signaling pathway
    9560 (CCL4L2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    9560 (CCL4L2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9560 (CCL4L2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   9560 (CCL4L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 9560
NCBI-ProteinID: NP_001278401
OMIM: 610757
HGNC: 24066
Ensembl: ENSG00000276070
Vega: OTTHUMG00000188420
Pharos: Q8NHW4(Tdark)
UniProt: Q8NHW4
Position
17q12
AA seq 96 aa AA seqDB search
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgactgtcctgtctctcctcgtgctagtagctgccttctgctctcta
gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg
aggaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag
ccagctgtggttgctgctccgggaaggatcccatccaccagagctgccccacatggacca
tggtcaggcagaggaagatgcctaccacaggcaagggataaagccagatga

DBGET integrated database retrieval system