KEGG   Homo sapiens (human): 9563Help
Entry
9563              CDS       T01001                                 

Gene name
H6PD, CORTRD1, G6PDH, GDH
Definition
(RefSeq) hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00030  Pentose phosphate pathway
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hsa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Network
N00311  NADPH generation
N00312  Mutation-inactivated H6PD to NADPH production
Disease
H01111  Cortisone reductase deficiency (CRD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    9563 (H6PD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     9563 (H6PD)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     9563 (H6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 9563
NCBI-ProteinID: NP_004276
OMIM: 138090
HGNC: 4795
Ensembl: ENSG00000049239
Vega: OTTHUMG00000001768
Pharos: O95479(Tbio)
UniProt: O95479
Position
1p36.22
AA seq 791 aa AA seqDB search
MWNMLIVAMCLALLGCLQAQELQGHVSIILLGATGDLAKKYLWQGLFQLYLDEAGRGHSF
SFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQAL
NKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIARNINSSCRPGPGAWLRVVLEKPFGHDH
FSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLWNRHHVERVEII
MKETVDAEGRTSFYEEYGVIRDVLQNHLTEVLTLVAMELPHNVSSAEAVLRHKLQVFQAL
RGLQRGSAVVGQYQSYSEQVRRELQKPDSFHSLTPTFAAVLVHIDNLRWEGVPFILMSGK
ALDERVGYARILFKNQACCVQSEKHWAAAQSQCLPRQLVFHIGHGDLGSPAVLVSRNLFR
PSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLL
ASWNFWTPLLESLAHKAPRLYPGGAENGRLLDFEFSSGRLFFSQQQPEQLVPGPGPAPMP
SDFQVLRAKYRESPLVSAWSEELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQ
QLATAHYGFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLLQHVRIPYYNIHPMPVHLQQ
RLCAEEDQGAQIYAREISALVANSSFDLVLLGMGADGHTASLFPQSPTGLDGEQLVVLTT
SPSQPHRRMSLSLPLINRAKKVAVLVMGRMKREITTLVSRVGHEPKKWPISGVLPHSGQL
VWYMDYDAFLG
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatatgctcatagtggcgatgtgcttggcccttctgggctgcctgcaagcccag
gagctccagggacatgtctccataatcctgctgggagcaactggggacctggctaagaag
tacttatggcagggactgttccagctgtacctggatgaagcggggaggggtcacagtttt
agcttccatggagctgctctgacagcccccaagcagggtcaagagctcatggccaaggcc
ctggaatccctctcctgccccaaggacatggcacccagtcactgtgcagagcacaaggat
cagttcctgcagctgagccagtaccgccaactgaagacggccgaggactatcaggccctg
aacaaggacatcgaggcacagctccagcacgcaggcctccgggaggctggcaggatcttc
tacttctcagtgccacccttcgcctatgaagacattgcccgcaacatcaacagtagctgc
cggccaggcccgggcgcctggctgcgggttgtccttgagaaaccctttggccatgaccac
ttctcagcccagcagctggccacagaactcgggacctttttccaggaggaggagatgtac
cgggtggaccattacttaggcaagcaggctgtggcgcagatcctgcctttccgagaccag
aaccgcaaggctttggacggcctctggaaccggcaccatgtggagcgggtggagatcatc
atgaaagagaccgtggatgctgaaggccgcaccagcttctatgaggagtacggtgtcatt
cgcgacgtcctccagaaccatctgacggaggtcctcaccctcgtggccatggagctgccc
cacaatgtcagcagtgcggaggctgtgctgcggcacaagcttcaggtcttccaggcgctg
cggggcctgcagaggggcagtgccgtcgtgggccagtaccagtcttacagtgagcaggtg
cgcagagagctgcagaagccagacagcttccacagcctgacgccgaccttcgcagccgtc
ctagtgcacattgacaaccttcgctgggagggcgtgcctttcatcctgatgtctggcaaa
gccttggacgagagagtgggctacgctcggatcttgttcaagaaccaggcctgctgtgtg
cagagcgaaaagcactgggccgcggcgcagagccagtgcctgccccggcagctcgtcttc
cacatcggccatggcgacctgggcagccctgccgtgctggtcagcaggaacctgttcagg
ccctccctgccctccagctggaaggaaatggagggaccacctgggctccgccttttcggc
agccctctgtccgattactacgcctacagccctgtgcgggagcgggacgcccactccgtc
ctcttatcccatatcttccatggccggaagaatttcttcatcaccacagagaacttgctg
gcctcctggaacttctggacccctctgctggagagcctggcccataaggccccacgcctc
taccctggaggagctgagaatggccgtctgttggactttgagttcagtagcggccggttg
ttcttttcccagcagcagccggagcagctggtgccagggccagggccggccccaatgccc
agtgacttccaggtcctcagggccaagtaccgagagagcccgctggtctccgcctggtcc
gaggagctgatctctaagctggctaatgacatcgaggccaccgctgtgcgagccgtgcgg
cgctttggccagttccacctggcactgtcggggggctcgagccccgtggccctgttccag
cagctggccacggcgcactatggcttcccctgggcccacacgcacctgtggctggttgac
gagcgctgcgtcccactctcagacccggagtccaacttccagggcctgcaggcccacctg
ctgcagcacgtccggatcccctactacaacatccaccccatgcctgtgcacctgcagcag
cggctctgcgccgaggaggaccagggcgcccagatctatgccagggagatctcagccctg
gtggccaacagcagcttcgacctggtgctgctgggcatgggtgccgacgggcacacagcc
tccctcttcccacagtcacccactggcctggatggcgagcagctggtcgtgctgaccacg
agcccctcccagccacaccgccgcatgagccttagcctgcctctcatcaaccgcgccaag
aaggtggcagtcctggtcatgggcaggatgaagcgtgagatcaccacgctggtgagccgg
gtgggccatgagcccaagaagtggcccatctcgggtgtcctgccgcactccggccagctg
gtgtggtacatggactacgacgccttcctgggatga

DBGET integrated database retrieval system