KEGG   Homo sapiens (human): 9564Help
Entry
9564              CDS       T01001                                 

Gene name
BCAR1, CAS, CAS1, CASS1, CRKAS, P130Cas
Definition
(RefSeq) BCAR1 scaffold protein, Cas family member
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05135  Yersinia infection
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9564 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    9564 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9564 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9564 (BCAR1)
   04062 Chemokine signaling pathway
    9564 (BCAR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    9564 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    9564 (BCAR1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    9564 (BCAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2 Vinculin
Motif
Other DBs
NCBI-GeneID: 9564
NCBI-ProteinID: NP_001164189
OMIM: 602941
HGNC: 971
Ensembl: ENSG00000050820
Vega: OTTHUMG00000137604
Pharos: P56945(Tbio)
UniProt: P56945
Structure
PDB: 

Position
16q23.1
AA seq 870 aa AA seqDB search
MSVPNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTP
SKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQ
VPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL
LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPS
NHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAED
VYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREA
PAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDL
AGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAK
LSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGN
ASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGW
MEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVA
HSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP
SAAQDMVERVKELGHSTQQFRRVLGQLAAA
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcctaacgtgctggccaaagcgctctatgacaatgtggccgagtccccggat
gagctctccttccgcaagggtgacatcatgacggtgctggagcaggacacgcagggcctg
gacggctggtggctctgctcgctgcatgggcgccagggcatcgtgcctgggaaccgcctc
aagatcttggtgggcatgtatgataagaagccagcagggcctggccccggccctcccgcc
accccggcccagcctcagcctggcctccatgccccagcgcctccggcctcccagtacacg
cccatgctccccaacacctaccagccccagccagacagcgtctacctggtgcccactccc
agcaaggctcagcaaggcctctaccaagtcccgggtcccagccctcagttccagtctccc
ccagccaagcagacatccaccttctcgaagcagacaccccatcacccgtttcccagcccg
gccacagacctgtaccaggtgcccccagggcctggaggccctgcccaggatatttaccag
gtgccaccttctgccgggatggggcatgacatctaccaggtccccccgtccatggacaca
cgcagctgggagggcacgaagcccccggcaaaggtggtggtgcccacccgcgtggggcag
ggctatgtatacgaggccgcccagccggagcaggacgagtacgacatcccgcgacacctg
ctggccccggggccacaggacatctatgatgtgcccccggttcgggggctgcttcccagc
cagtatggccaggaggtgtatgacacaccccccatggctgtcaagggtcccaatggccga
gacccgttgctggaggtgtatgacgtgccccccagtgtggagaagggcctgccaccgtcc
aaccaccacgcagtctacgacgttcctccatcggtgagcaaggatgtgcccgatggccca
ctgctgcgtgaggagacctacgatgtgccccccgccttcgccaaggccaagccctttgac
ccggcccgcaccccactggtactggctgcgccccctccagactccccgccggccgaggac
gtgtatgacgtgccgcccccggctcctgacctctacgacgtgccccctggcttgcggcgg
cctggcccgggcaccctgtacgatgtgccccgtgaacgggtgcttcctcctgaggtggct
gatggtggcgtggtcgacagtggtgtgtatgcggtgcctcccccagctgaacgtgaagcc
ccggcagagggcaagcgcctgtcggcctccagcaccggcagcacacgcagcagccagtct
gcgtcctccttggaggtggcagggccgggccgggaacccctggagctggaagttgctgtg
gaggccctggcacggctgcagcagggtgtgagcgccaccgttgcccaccttctggacctg
gcaggcagcgccggtgcgactgggagctggcgtagcccctctgagccacaggagccgctg
gtgcaggacctgcaggctgctgtggccgctgtccagagtgccgtccacgagctgttggag
tttgcccgcagcgcggtgggcaatgctgcccacacatctgaccgtgccctgcatgccaag
cttagccggcagctgcagaagatggaggacgtgcaccagacgctggtggcacatggtcag
gccctcgacgctggccggggaggctctggagccacccttgaggacctggaccggctggtg
gcctgctcgcgggctgtgcccgaggacgccaagcagctggcctccttcctgcacggcaat
gcctcactgctcttcagacggaccaaggccactgccccggggcctgaggggggtggcacc
ctgcaccccaaccccactgacaagaccagcagcatccagtcacgacccctgccctcaccc
cctaagttcacctcccaggactcgccagatgggcagtacgagaacagcgaggggggctgg
atggaggactatgactacgtccacctacaggggaaggaggagtttgagaagacccagaag
gagctgctggaaaagggcagcatcacgcggcagggcaagagccagctggagttgcagcag
ctgaagcagtttgaacgactggaacaggaggtgtcacggcccatagaccacgacctggcc
aactggacgccagcccaacccctggccccggggcgaacaggcggcctggggccctcggac
cggcagctgctgctcttctacctggagcagtgtgaggccaacctgaccacactgaccaac
gccgtggacgccttctttaccgccgtggccaccaaccagccgcccaagatctttgtggcg
cacagcaagttcgtcatcctcagcgcccacaagctggtgttcatcggggacacactgtca
cggcaggccaaggctgctgacgtgcgcagccaggtgacccactacagcaacctgctgtgc
gacctcctgcgcggcatcgtggccaccaccaaggccgctgccttgcagtacccatcgcct
tccgcggcccaggacatggtggagagggtcaaggagctgggccacagcacccagcagttc
cgccgcgtcctaggccagctggcagccgcctga

DBGET integrated database retrieval system