KEGG   Homo sapiens (human): 9567
Entry
9567              CDS       T01001                                 

Gene name
GTPBP1, GP-1, GP1, HSPC018
Definition
(RefSeq) GTP binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1 Dynamin_N
Other DBs
NCBI-GeneID: 9567
NCBI-ProteinID: NP_004277
OMIM: 602245
HGNC: 4669
Ensembl: ENSG00000100226
Vega: OTTHUMG00000151002
Pharos: O00178(Tbio)
UniProt: O00178
Position
22q13.1
AA seq 669 aa
MATERSRSAMDSPVPASMFAPEPSSPGAARAAAAAARLHGGFDSDCSEDGEALNGEPELD
LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATV
KSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVL
THGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKI
CEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALN
VPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMC
PIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGL
IKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMV
SPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATV
HFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLT
KRDEGGPSGGPAVGAPPPGDEASSVGAGQPAASSNLQPQPKPSSGGRRRGGQRHKVKSQG
ACVTPASGC
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggcgacggagcgcagtcgctccgcgatggactcgccggtcccggcctctatgttcgcc
cccgagcccagctccccgggggcggccagggccgcggcggccgccgcccgactccacggc
ggctttgactcggactgcagcgaggacggcgaggcgctcaacggcgagccagagctggac
ctcaccagcaagctggttctagtgagccctacatcagagcagtatgacagcctacttcgg
cagatgtgggagaggatggacgagggatgcggagagaccatatatgtcattgggcaggga
tcagatgggactgagtatgggctgagtgaagctgacatggaggcctcctacgccacagtg
aagagcatggcggaacagatagaggccgatgtcatccttctgcgggaacggcaagaagct
gggggccgcgtgcgtgattacctggtccggaaacgagtaggagacaatgacttcctggag
gtcagggtagcagtggtgggcaacgtggatgctggcaaaagcacgcttctgggggtcctg
acacatggggagctggacaatggccgaggctttgcccgccagaaactcttccgccacaaa
catgaaattgaatctggtcgcaccagcagtgtgggcaacgacattctgggctttgacagt
gaaggcaatgtagtgaacaagcctgacagccacggcggcagcctggagtggaccaagatc
tgtgagaagtccacgaaagtcattaccttcatcgacttggctggtcatgagaagtacctg
aaaaccactgtcttcggcatgacaggccatctgcctgacttctgcatgctcatggtgggc
agcaatgctggcatcgtggggatgaccaaagaacacctgggcttggcactggcactcaat
gtacctgtctttgtggtagtcaccaagattgacatgtgtcctgccaacatcctgcaagaa
accctgaagctgttacagcgcctgctgaagtcaccaggctgccggaagatccccgtgctg
gtgcagagcaaagatgatgtgattgtcacagcctccaacttcagctctgaaaggatgtgc
ccgatattccagatctccaacgttacaggcgagaacctagatctgctgaagatgttcctc
aacctcctctccccccgcaccagctacagggaggaggagcctgctgagtttcagattgat
gacacctactccgtcccgggtgtggggacagtggtttcggggacaacactgagaggcctg
atcaagctgaatgacacgctgctgctgggcccagaccccttgggtaacttcctgtccatt
gctgtcaaatccatccatcgcaagcgcatgcctgtcaaggaggtgcggggtggccagaca
gcatcctttgcgctgaagaagatcaagcgctcgtccatccggaagggcatggtgatggtt
tccccacgtttgaatccccaagcctcctgggagtttgaggccgagattctcgtcctccac
caccccaccacaattagcccgcgctaccaggccatggtgcactgtgggagcatcaggcag
acagccaccattctgagcatggacaaggactgtctgcgcactggggacaaggccactgta
cacttccgcttcatcaagacccctgagtacctgcacatagaccagcggctggtgttccgg
gaaggccgcaccaaggctgtcggcaccatcaccaagctcctccagaccaccaacaactcc
ccaatgaactccaagccgcagcagattaaaatgcagtcgacgaaaaagggccccctgacg
aaacgagacgaggggggcccgtctggtgggccagcagtaggagcacccccacctggagat
gaagcctcctctgtaggggcagggcaaccagctgcgtccagcaatctccagcctcagcct
aagcccagcagtggaggccggcgacgagggggccagcgccacaaggtgaagtcccagggg
gcctgtgtgactcctgccagcggctgctga

DBGET integrated database retrieval system