KEGG   Homo sapiens (human): 9570Help
Entry
9570              CDS       T01001                                 

Gene name
GOSR2, Bos1, EPM6, GS27
Definition
(RefSeq) golgi SNAP receptor complex member 2
  KO
K08496  golgi SNAP receptor complex member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9570 (GOSR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9570 (GOSR2)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[N] (Qb)
   Bos1 / Membrin
    9570 (GOSR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-SNARE_C Sec20 EzrA V-SNARE SLX9 Endonuc-dimeris EF-G-binding_N
Motif
Other DBs
NCBI-GeneID: 9570
NCBI-ProteinID: NP_004278
OMIM: 604027
HGNC: 4431
Ensembl: ENSG00000108433
Vega: OTTHUMG00000178080
Pharos: O14653(Tbio)
UniProt: O14653
Position
17q21.32
AA seq 212 aa AA seqDB search
MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPP
NKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPM
DESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMR
LIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggatcccctgttccagcaaacgcacaagcaggtccacgagatccagtcttgcatggga
cgcctggagacggcagacaagcagtctgtgcacatagtagaaaacgaaatccaagcaagc
atagaccagatattcagccgtctagaacgtctggagattttgtccagcaaggagccccct
aacaaaaggcaaaatgccagacttcgggttgaccagttaaagtatgatgtccagcacctg
cagactgcgctcagaaacttccagcatcggcgccatgcaagggagcagcaggagagacag
cgagaagagcttctgtctcgaaccttcaccactaacgactctgacaccaccataccaatg
gacgaatcactgcagtttaactcctccctccagaaagttcacaacggcatggatgacctc
attttagatgggcacaatattttagatggactgaggacccagagactgaccttgaagggg
actcagaagaagatccttgacattgccaacatgctgggcttgtccaacacagtgatgcgg
ctcatcgagaagcgggctttccaggacaagtactttatgataggtgggatgctgctgacc
tgtgtggtcatgttcctcgtggtgcagtacctgacatga

DBGET integrated database retrieval system