KEGG   Homo sapiens (human): 9572Help
Entry
9572              CDS       T01001                                 

Gene name
NR1D1, EAR1, REVERBA, REVERBalpha, THRA1, THRAL, ear-1, hRev
Definition
(RefSeq) nuclear receptor subfamily 1 group D member 1
  KO
K03728  nuclear receptor subfamily 1 group D member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    9572 (NR1D1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9572 (NR1D1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    9572 (NR1D1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    9572 (NR1D1)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   9572 (NR1D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 9572
NCBI-ProteinID: NP_068370
OMIM: 602408
HGNC: 7962
Ensembl: ENSG00000126368
Vega: OTTHUMG00000133327
Pharos: P20393(Tchem)
UniProt: P20393 F1D8S3
Structure
PDB: 

Position
17q21.1
AA seq 614 aa AA seqDB search
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctggactccaacaacaacacaggtggcgtcatcacctacattggctccagt
ggctcctccccaagccgcaccagccctgaatccctctatagtgacaactccaatggcagc
ttccagtccctgacccaaggctgtcccacctacttcccaccatcccccactggctccctc
acccaagacccggctcgctcctttgggagcattccacccagcctgagtgatgacggctcc
ccttcttcctcatcttcctcgtcgtcatcctcctcctccttctataatgggagcccccct
gggagtctacaagtggccatggaggacagcagccgagtgtcccccagcaagagcaccagc
aacatcaccaagctgaatggcatggtgttactgtgtaaagtgtgtggggacgttgcctcg
ggcttccactacggtgtgcacgcctgcgagggctgcaagggctttttccgtcggagcatc
cagcagaacatccagtacaaaaggtgtctgaagaatgagaattgctccatcgtccgcatc
aatcgcaaccgctgccagcaatgtcgcttcaagaagtgtctctctgtgggcatgtctcga
gacgctgtgcgttttgggcgcatccccaaacgagagaagcagcggatgcttgctgagatg
cagagtgccatgaacctggccaacaaccagttgagcagccagtgcccgctggagacttca
cccacccagcaccccaccccaggccccatgggcccctcgccaccccctgctccggtcccc
tcacccctggtgggcttctcccagtttccacaacagctgacgcctcccagatccccaagc
cctgagcccacagtggaggatgtgatatcccaggtggcccgggcccatcgagagatcttc
acctacgcccatgacaagctgggcagctcacctggcaacttcaatgccaaccatgcatca
ggtagccctccagccaccaccccacatcgctgggaaaatcagggctgcccacctgccccc
aatgacaacaacaccttggctgcccagcgtcataacgaggccctaaatggtctgcgccag
gctccctcctcctaccctcccacctggcctcctggccctgcacaccacagctgccaccag
tccaacagcaacgggcaccgtctatgccccacccacgtgtatgcagccccagaaggcaag
gcacctgccaacagtccccggcagggcaactcaaagaatgttctgctggcatgtcctatg
aacatgtacccgcatggacgcagtgggcgaacggtgcaggagatctgggaggatttctcc
atgagcttcacgcccgctgtgcgggaggtggtagagtttgccaaacacatcccgggcttc
cgtgacctttctcagcatgaccaagtcaccctgcttaaggctggcacctttgaggtgctg
atggtgcgctttgcttcgttgttcaacgtgaaggaccagacagtgatgttcctaagccgc
accacctacagcctgcaggagcttggtgccatgggcatgggagacctgctcagtgccatg
ttcgacttcagcgagaagctcaactccctggcgcttaccgaggaggagctgggcctcttc
accgcggtggtgcttgtctctgcagaccgctcgggcatggagaattccgcttcggtggag
cagctccaggagacgctgctgcgggctcttcgggctctggtgctgaagaaccggcccttg
gagacttcccgcttcaccaagctgctgctcaagctgccggacctgcggaccctgaacaac
atgcattccgagaagctgctgtccttccgggtggacgcccagtga

DBGET integrated database retrieval system