KEGG   Homo sapiens (human): 9573
Entry
9573              CDS       T01001                                 

Gene name
GDF3, KFS3, MCOP7, MCOPCB6
Definition
(RefSeq) growth differentiation factor 3
  KO
K22672  growth differentiation factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H00852  Klippel-Feil syndrome
H01027  Microphthalmia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9573 (GDF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9573 (GDF3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   9573 (GDF3)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 9573
NCBI-ProteinID: NP_065685
OMIM: 606522
HGNC: 4218
Ensembl: ENSG00000184344
Vega: OTTHUMG00000168433
Pharos: Q9NR23(Tbio)
UniProt: Q9NR23
Position
12p13.31
AA seq 364 aa
MLRFLPDLAFSFLLILALGQAVQFQEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREA
AATTGVSRDLCYVKELGVRGNVLRFLPDQGFFLYPKKISQASSCLQKLLYFNLSAIKERE
QLTLAQLGLDLGPNSYYNLGPELELALFLVQEPHVWGQTTPKPGKMFVLRSVPWPQGAVH
FNLLDVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASLLVVTLNP
DQCHPSRKRRAAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFS
LTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDE
CGCG
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcttcgtttcttgccagatttggctttcagcttcctgttaattctggctttgggccag
gcagtccaatttcaagaatatgtctttctccaatttctgggcttagataaggcgccttca
ccccagaagttccaacctgtgccttatatcttgaagaaaattttccaggatcgcgaggca
gcagcgaccactggggtctcccgagacttatgctacgtaaaggagctgggcgtccgcggg
aatgtacttcgctttctcccagaccaaggtttctttctttacccaaagaaaatttcccaa
gcttcctcctgcctgcagaagctcctctactttaacctgtctgccatcaaagaaagggaa
cagttgacattggcccagctgggcctggacttggggcccaattcttactataacctggga
ccagagctggaactggctctgttcctggttcaggagcctcatgtgtggggccagaccacc
cctaagccaggtaaaatgtttgtgttgcggtcagtcccatggccacaaggtgctgttcac
ttcaacctgctggatgtagctaaggattggaatgacaacccccggaaaaatttcgggtta
ttcctggagatactggtcaaagaagatagagactcaggggtgaattttcagcctgaagac
acctgtgccagactaagatgctcccttcatgcttccctgctggtggtgactctcaaccct
gatcagtgccacccttctcggaaaaggagagcagccatccctgtccccaagctttcttgt
aagaacctctgccaccgtcaccagctattcattaacttccgggacctgggttggcacaag
tggatcattgcccccaaggggttcatggcaaattactgccatggagagtgtcccttctca
ctgaccatctctctcaacagctccaattatgctttcatgcaagccctgatgcatgccgtt
gacccagagatcccccaggctgtgtgtatccccaccaagctgtctcccatttccatgctc
taccaggacaataatgacaatgtcattctacgacattatgaagacatggtagtcgatgaa
tgtgggtgtgggtag

DBGET integrated database retrieval system