KEGG   Homo sapiens (human): 9575Help
Entry
9575              CDS       T01001                                 

Gene name
CLOCK, KAT13D, bHLHe8
Definition
(RefSeq) clock circadian regulator
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04728  Dopaminergic synapse
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    9575 (CLOCK)
  09159 Environmental adaptation
   04710 Circadian rhythm
    9575 (CLOCK)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    9575 (CLOCK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9575 (CLOCK)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9575 (CLOCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     9575 (CLOCK)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    9575 (CLOCK)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    9575 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9
Motif
Other DBs
NCBI-GeneID: 9575
NCBI-ProteinID: NP_001254772
OMIM: 601851
HGNC: 2082
Ensembl: ENSG00000134852
Vega: OTTHUMG00000102141
Pharos: O15516(Tbio)
UniProt: O15516 Q3ZCT4
Structure
PDB: 

Position
4q12
AA seq 846 aa AA seqDB search
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQ
PPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDP
SKVQPQ
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagatgacagtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcgaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatctactgttctgcagaaaagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
accccagaatatttaaaatcaaaaaatcagttagaattctgttgtcacatgctgcgagga
acaatagacccaaaggagccatctacctatgaatatgtaaaatttataggaaatttcaaa
tctttaaacagtgtatcctcttcagcacacaatggttttgaaggaactatacaacgcaca
cataggccatcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacccaatgaagagtttacatctagacat
agtttagaatggaagtttctgtttctagatcacagggcaccacccataatagggtatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaaatgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctgactaaggggcaacagtggatttggcttcagactcattattatatcacttaccat
cagtggaattcaaggccagagtttattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtcagataatcgtataaacacagtcagtctcaaggaagca
ttggaaaggtttgatcacagcccaaccccttctgcctcttctcggagttcaagaaaatca
tctcacacggccgtctcagacccttcctcaacaccaaccaagatcccgacggatacgagc
actccacccaggcagcatttaccagctcatgagaagatggtgcaaagaaggtcatcattt
agtagtcagtccataaattcccagtctgttggttcatcattaacacagccagtgatgtct
caagctacaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcaatta
ggagccatgcaacatctgaaagaccaattggaacaacggacacgcatgatagaagcaaat
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcagatggtccatggt
caggggctgcagatgtttttgcaacaatcaaatcctgggttgaattttggttccgttcaa
ctttcttctggaaattcatctaatatccagcaacttgcacctataaatatgcaaggccaa
gttgttcctactaaccagattcaaagtggaatgaatactggacacattggcacaactcag
cacatgatacaacaacagactttacagagtacatcaactcagagtcaacaaaatgtactg
agtgggcacagtcagcaaacatctctacccagtcagacacagagcactcttacagcccca
ctgtataacactatggtgatttctcagcctgcagccggaagcatggtccagattccatct
agtatgccacaaaacagcacccagagtgctgcagtaactacattcactcaggacaggcag
ataagattttctcaaggtcaacaacttgtgaccaaattagtgactgctcctgtagcttgt
ggggcagtcatggtacctagtactatgcttatgggccaggtggtgactgcatatcctact
tttgctacacaacagcaacagtcacagacattgtcagtaacgcagcagcagcagcagcag
agctcccaggagcagcagctcacttcagttcagcaaccatctcaggctcagctgacccag
ccaccgcaacaatttttacagacttctaggttgctccatgggaatccctcaactcaactc
attctctctgctgcatttcctctacaacagagcaccttccctcagtcacatcaccagcaa
catcagtctcagcaacagcagcaactcagccggcacaggactgacagcttgcccgaccct
tccaaggttcaaccacagtag

DBGET integrated database retrieval system