KEGG   Homo sapiens (human): 9578Help
Entry
9578              CDS       T01001                                 

Gene name
CDC42BPB, MRCKB
Definition
(RefSeq) CDC42 binding protein kinase beta
  KO
K16307  serine/threonine-protein kinase MRCK [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9578 (CDC42BPB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9578 (CDC42BPB)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   9578 (CDC42BPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase KELK Pkinase_Tyr DMPK_coil C1_1 Kinase-like PBD PH C1_2
Motif
Other DBs
NCBI-GeneID: 9578
NCBI-ProteinID: NP_006026
OMIM: 614062
HGNC: 1738
Ensembl: ENSG00000198752
Vega: OTTHUMG00000171898
Pharos: Q9Y5S2(Tbio)
UniProt: Q9Y5S2 A0A024R6N2 Q86XZ8
Structure
PDB: 

Position
14q32.32
AA seq 1711 aa AA seqDB search
MSAKVRLKKLEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAK
PFTQLVKEMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETAC
FREERDVLVNGDCQWITALHYAFQDENHLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFY
IGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTP
DYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERF
QFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPD
VSSPSDTSNFDVDDDVLRNTEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSIMQ
SNTLTKDEDVQRDLEHSLQMEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSSRALSN
SNRDKEIKKLNEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQ
EKEELHKQLVEASERLKSQAKELKDAHQQRKLALQEFSELNERMAELRAQKQKVSRQLRD
KEEEMEVATQKVDAMRQEMRRAEKLRKELEAQLDDAVAEASKERKLREHSENFCKQMESE
LEALKVKQGGRGAGATLEHQQEISKIKSELEKKVLFYEEELVRREASHVLEVKNVKKEVH
DSESHQLALQKEILMLKDKLEKSKRERHNEMEEAVGTIKDKYERERAMLFDENKKLTAEN
EKLCSFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQALAS
KMTEELEALRSSSLGSRTLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKV
KDANLTLESKLKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIFEYFNTAPL
AHDLTFRTSSASEQETQAPKPEASPSMSVAASEQQEDMARPPQRPSAVPLPTTQALALAG
PKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEVCSFACHVSCKDGAPQVCPIPPE
QSKRPLGVDVQRGIGTAYKGHVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKSTQPG
VIASQVLDLRDDEFSVSSVLASDVIHATRRDIPCIFRVTASLLGAPSKTSSLLILTENEN
EKRKWVGILEGLQSILHKNRLRNQVVHVPLEAYDSSLPLIKAILTAAIVDADRIAVGLEE
GLYVIEVTRDVIVRAADCKKVHQIELAPREKIVILLCGRNHHVHLYPWSSLDGAEGSFDI
KLPETKGCQLMATATLKRNSGTCLFVAVKRLILCYEIQRTKPFHRKFNEIVAPGSVQCLA
VLRDRLCVGYPSGFCLLSIQGDGQPLNLVNPNDPSLAFLSQQSFDALCAVELESEEYLLC
FSHMGLYVDPQGRRARAQELMWPAAPVACSCSPTHVTVYSEYGVDVFDVRTMEWVQTIGL
RRIRPLNSEGTLNLLNCEPPRLIYFKSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKV
PEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERP
GPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTPS
NSSNPSGPPSPNSPHRSQLPLEGLEQPACDT
NT seq 5136 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccaaggtgcggctcaagaagctggagcagctgctcctggacgggccctggcgc
aacgagagcgccctgagcgtggaaacgctgctcgacgtgctcgtctgcctgtacaccgag
tgcagccactcggccctgcgccgcgacaagtacgtggccgagttcctcgagtgggctaaa
ccatttacacagctggtgaaagaaatgcagcttcatcgagaagactttgaaataattaaa
gtaattggaagaggtgcttttggtgaggttgctgttgtcaaaatgaagaatactgaacga
atttatgcaatgaaaatcctcaacaagtgggagatgctgaaaagagcagagaccgcgtgc
ttccgagaggagcgcgatgtgctggtgaacggcgactgccagtggatcaccgcgctgcac
tacgcctttcaggacgagaaccacctgtacttagtcatggattactatgtgggtggtgat
ttactgaccctgctcagcaaatttgaagacaagcttccggaagatatggcgaggttctac
attggtgaaatggtgctggccattgactccatccatcagcttcattacgtgcacagagac
attaaacctgacaatgtccttttggacgtgaatggtcatatccgcctggctgactttgga
tcatgtttgaagatgaatgatgatggcactgtgcagtcctccgtggccgtgggcacacct
gactacatctcgccggagatcctgcaggcgatggaggacggcatgggcaaatacgggcct
gagtgtgactggtggtctctgggtgtctgcatgtatgagatgctctatggagaaacgccg
ttttatgcggagtcactcgtggagacctatgggaagatcatgaaccatgaagagcgattc
cagttcccatcccatgtcacggatgtatctgaagaagcgaaggacctcatccagagactg
atctgcagtagagaacgccggctggggcagaatggaatagaggatttcaaaaagcatgcg
ttttttgaaggtctaaattgggaaaatatacgaaacctagaagcaccttatattcctgat
gtgagcagtccctctgacacatccaacttcgacgtggatgacgacgtgctgagaaacacg
gaaatattacctcctggttctcacacaggcttttctggattacatttgccattcattggt
tttacattcacaacggaaagctgtttttctgatcgaggctctctgaagagcataatgcag
tccaacacattaaccaaagatgaggatgtgcagcgggacctggagcacagcctgcagatg
gaagcttacgagaggaggattcggaggctggaacaggagaagctggagctgagcaggaag
ctgcaagagtccacccagaccgtgcagtccctccacggctcatctcgggccctcagcaat
tcaaaccgagataaagaaatcaaaaagctaaatgaagaaatcgaacgcttgaagaataaa
atagcagattcaaacaggctcgagcgacagcttgaggacacagtggcgcttcgccaagag
cgtgaggactccacgcagcggctgcgggggctggagaagcagcaccgcgtggtccggcag
gagaaggaggagctgcacaagcaactggttgaagcctcagagcggttgaaatcccaggcc
aaggaactcaaagatgcccatcagcagcgaaagctggccctgcaggagttctcggagctg
aacgagcgcatggcagagctccgtgcccagaagcagaaggtgtcccggcagctgcgagac
aaggaggaggagatggaggtggccacgcagaaggtggacgccatgcggcaggaaatgcgg
agagctgagaagctcaggaaagagctggaagctcagcttgatgatgctgttgctgaggcc
tccaaggagcgcaagcttcgtgagcacagcgagaacttctgcaagcaaatggaaagcgag
ctggaggccctcaaggtgaagcaaggaggccggggagcgggtgccaccttagagcaccag
caagagatttccaaaatcaaatccgagctggagaagaaagtcttattttatgaagaggaa
ttggtcagacgtgaggcctcccatgtgctagaagtgaaaaatgtgaagaaggaggtgcat
gattcagaaagccaccagctggccctgcagaaagaaatcttgatgttaaaagataagtta
gaaaagtcaaagcgagaacggcataacgagatggaggaggcagtaggtacaataaaagat
aaatacgaacgagaaagagcgatgctgtttgatgaaaacaagaagctaactgctgaaaat
gaaaagctctgttcctttgtggataaactcacagctcaaaatagacagctggaggatgag
ctgcaggatctggcagccaagaaggagtcagtggcccactgggaagctcagattgcggaa
atcattcagtgggtcagtgacgagaaagatgcccggggttaccttcaagctcttgcttcc
aagatgaccgaagagctcgaggctttgaggagttctagtctggggtcaagaacactggac
ccgctgtggaaggtgcgccgcagccagaagctggacatgtccgcgcggctggagctgcag
tcggccctggaggcggagatccgggccaagcagcttgtccaggaggagctcaggaaggtc
aaggacgccaacctcaccttggaaagcaaactaaaggattccgaagccaaaaacagagaa
ttattagaagaaatggaaattttgaagaaaaagatggaagaaaaattcagagcagatact
gggctcaaacttccagattttcaggattccatttttgagtatttcaacactgctcctctt
gcacatgacctgacatttagaaccagctcagctagtgagcaagaaacacaagctccgaag
ccagaagcgtccccgtcgatgtctgtggctgcatcagagcagcaggaggacatggctcgg
cccccgcagaggccatccgctgtgccgttgcccaccacgcaggccctggctctggctgga
ccgaagccaaaagctcaccagttcagcatcaagtccttctccagccctactcagtgcagc
cactgcacctccctgatggttgggctgatccggcagggctacgcctgcgaggtgtgttcc
tttgcttgccacgtgtcctgcaaagacggtgccccccaggtgtgcccaatacctcccgag
cagtccaagaggcctctgggcgtggacgtgcagcgaggcatcggaacagcctacaaaggc
catgtcaaggtcccaaagcccacgggggtgaagaagggatggcagcgcgcatatgcagtc
gtctgtgactgcaagctcttcctgtatgatctgcctgaaggaaaatccacccagcctggt
gtcattgcgagccaagtcttggatctcagagatgacgagttttccgtgagctcagtcctg
gcctcagatgtcattcatgctacacgccgagatattccatgtatattcagggtgacggcc
tctctcttaggtgcaccttctaagaccagctcgctgctcattctgacagaaaatgagaat
gaaaagaggaagtgggttgggattctagaaggactccagtccatccttcataaaaaccgg
ctgaggaatcaggtcgtgcatgttcccttggaagcctacgacagctcgctgcctctcatc
aaggccatcctgacagctgccatcgtggatgcagacaggattgcagtcggcctagaagaa
gggctctatgtcatagaggtcacccgagatgtgatcgtccgtgccgctgactgtaagaag
gtacaccagatcgagcttgctcccagggagaagatcgtaatcctcctctgtggccggaac
caccatgtgcacctctatccgtggtcgtcccttgatggagcggaaggcagctttgacatc
aagcttccggaaaccaaaggctgccagctcatggccacggccacactcaagaggaactct
ggcacctgcctgtttgtggccgtgaaacggctgatcctttgctatgagatccagagaacg
aagccattccacagaaagttcaatgagattgtggctcccggcagcgtgcagtgcctggcg
gtgctcagggacaggctctgtgtgggctacccttctgggttctgcctgctgagcatccag
ggggacgggcagcctctaaacctggtaaatcccaatgacccctcgcttgcgttcctctca
caacagtcttttgatgccctttgtgctgtggagctcgaaagcgaggagtacctgctttgc
ttcagccacatgggactgtacgtggacccgcaaggccggagggcacgcgcgcaggagctc
atgtggcctgcggctcctgtcgcctgtagttgcagccccacccacgtcacggtgtacagc
gagtatggcgtggacgtctttgatgtgcgcaccatggagtgggtgcagaccatcggcctg
cggaggataaggcccctgaactctgaaggcaccctcaacctcctcaactgcgagcctcca
cgcttgatctacttcaagagcaagttctcgggagcggttctcaacgtgccggacacctcc
gacaacagcaagaagcagatgctgcgcaccaggagcaaaaggcggttcgtcttcaaggtc
ccagaggaagagagactgcagcagaggcgagagatgcttagagacccagaattgagatcc
aaaatgatatccaacccaaccaacttcaaccacgtggcccacatgggcccaggcgacggc
atgcaggtgctcatggacctgcctctgagtgctgtgcccccctcccaggaggaaaggccg
ggccccgctcccaccaacctggctcgccagcctccatccaggaacaagccctacatctcg
tggccctcatcaggtggatcggagcctagcgtgactgtgcctctgagaagtatgtctgat
ccagaccaggactttgacaaagagcctgattcggactccaccaaacactcaactccatcg
aatagctccaaccccagcggcccaccgagccccaactccccccacaggagccagctcccc
ctcgaaggcctggagcagccggcctgtgacacctga

DBGET integrated database retrieval system