KEGG   Homo sapiens (human): 958Help
Entry
958               CDS       T01001                                 

Gene name
CD40, Bp50, CDW40, TNFRSF5, p50
Definition
(RefSeq) CD40 molecule
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04620  Toll-like receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05202  Transcriptional misregulation in cancer
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05330  Allograft rejection
hsa05340  Primary immunodeficiency
hsa05416  Viral myocarditis
Network
N00123  Amplified REL to transcription
Disease
H00086  Hyper IgM syndromes, autosomal recessive type
H00093  Combined immunodeficiency
Drug target
Dacetuzumab: D08896
Lucatumumab: D08942
Teneliximab: D06071
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    958 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    958 (CD40)
   04514 Cell adhesion molecules (CAMs)
    958 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    958 (CD40)
   04672 Intestinal immune network for IgA production
    958 (CD40)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    958 (CD40)
  09163 Immune diseases
   05310 Asthma
    958 (CD40)
   05322 Systemic lupus erythematosus
    958 (CD40)
   05320 Autoimmune thyroid disease
    958 (CD40)
   05330 Allograft rejection
    958 (CD40)
   05340 Primary immunodeficiency
    958 (CD40)
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    958 (CD40)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    958 (CD40)
   05169 Epstein-Barr virus infection
    958 (CD40)
  09174 Infectious diseases: Parasitic
   05144 Malaria
    958 (CD40)
   05145 Toxoplasmosis
    958 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    958 (CD40)
   04090 CD molecules [BR:hsa04090]
    958 (CD40)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   958 (CD40)
CD molecules [BR:hsa04090]
 Proteins
  958 (CD40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 RANK_CRD_2 Glycophorin_A DUF2207 Syndecan
Motif
Other DBs
NCBI-GeneID: 958
NCBI-ProteinID: NP_001241
OMIM: 109535
HGNC: 11919
Ensembl: ENSG00000101017
Vega: OTTHUMG00000033053
Pharos: P25942(Tchem)
UniProt: P25942 A0A0S2Z3C7 Q6P2H9
Structure
PDB: 

Position
20q13.12
AA seq 277 aa AA seqDB search
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtctgcctctgcagtgcgtcctctggggctgcttgctgaccgctgtccatcca
gaaccacccactgcatgcagagaaaaacagtacctaataaacagtcagtgctgttctttg
tgccagccaggacagaaactggtgagtgactgcacagagttcactgaaacggaatgcctt
ccttgcggtgaaagcgaattcctagacacctggaacagagagacacactgccaccagcac
aaatactgcgaccccaacctagggcttcgggtccagcagaagggcacctcagaaacagac
accatctgcacctgtgaagaaggctggcactgtacgagtgaggcctgtgagagctgtgtc
ctgcaccgctcatgctcgcccggctttggggtcaagcagattgctacaggggtttctgat
accatctgcgagccctgcccagtcggcttcttctccaatgtgtcatctgctttcgaaaaa
tgtcacccttggacaagctgtgagaccaaagacctggttgtgcaacaggcaggcacaaac
aagactgatgttgtctgtggtccccaggatcggctgagagccctggtggtgatccccatc
atcttcgggatcctgtttgccatcctcttggtgctggtctttatcaaaaaggtggccaag
aagccaaccaataaggccccccaccccaagcaggaaccccaggagatcaattttcccgac
gatcttcctggctccaacactgctgctccagtgcaggagactttacatggatgccaaccg
gtcacccaggaggatggcaaagagagtcgcatctcagtgcaggagagacagtga

DBGET integrated database retrieval system