KEGG   Homo sapiens (human): 9580
Entry
9580              CDS       T01001                                 

Gene name
SOX13, ICA12, Sox-13
Definition
(RefSeq) SRY-box transcription factor 13
  KO
K09269  transcription factor SOX5/6/13 (SOX group D)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9580 (SOX13)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    9580 (SOX13)
SSDB
Motif
Pfam: HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 9580
NCBI-ProteinID: NP_005677
OMIM: 604748
HGNC: 11192
Ensembl: ENSG00000143842
Vega: OTTHUMG00000036050
Pharos: Q9UN79(Tbio)
UniProt: Q9UN79
Position
1q32.1
AA seq 622 aa
MSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSAD
PQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLS
SDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTAHSEQKNMAAML
FEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLP
VTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAKPK
APELPNTSSSPSLKMSSCVPRPPSHGGPTRDLQSSPPSLPLGFLGEGDAVTKAIQDARQL
LHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDMDGSRHFPESRN
SSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARL
SRQHLEKYPDYKYKPRPKRTCIVEGKRLRVGEYKALMRTRRQDARQSYVIPPQAGQVQMS
SSDVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYR
YSEDEDSEGEEKSDGELVVLTD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgtccatgaggagccccatctctgcccagctggccctggatggcgttggcaccatggtg
aactgcaccatcaagtcagaggagaagaaagagccttgccacgaggccccccagggctca
gccactgccgctgaacctcagcctggagacccagcccgggcctcccaggatagtgctgac
ccccaagctccagcccaggggaatttcaggggctcctgggactgtagctctccagagggt
aatgggtccccagaacccaagagaccaggagtgtcggaggctgcctctggaagccaggag
aagctggacttcaaccgaaatttgaaagaagtggtgccagccatagagaagctgttgtcc
agtgactggaaggagaggtttctaggaaggaactctatggaagccaaagatgtcaaaggg
acccaagagagcctagcagagaaggagctccagcttctggtcatgattcaccagctgtcc
accctgcgggaccagctcctgacagcccactcggagcagaagaacatggctgccatgctg
tttgagaagcagcagcagcagatggagcttgcccggcagcagcaggagcagattgcaaag
cagcagcagcagctgattcagcagcagcataagatcaacctccttcagcagcagatccag
caggttaacatgccttatgtcatgatcccagccttccccccaagccaccaacctctgcct
gtcacccctgactcccagctggccttacccattcagcccattccctgcaaaccagtggag
tatccgctgcagctgctgcacagcccccctgccccagtggtgaagaggcctggggccatg
gccacccaccaccccctgcaggagccctcccagcccctgaacctcacagccaagcccaag
gcccccgagctgcccaacacctccagctccccaagcctgaagatgagcagctgtgtgccc
cgcccccccagccatggaggccccacgcgggacctgcagtccagccccccgagcctgcct
ctgggcttccttggtgaaggggacgctgtcaccaaagccatccaggatgctcggcagctg
ctgcacagccacagtggggccttggatggctcccccaacacccccttccgtaaggacctc
atcagcctggactcatccccagccaaggagcggctggaggacggctgtgtgcacccactg
gaggaagccatgctgagctgcgacatggatggctcccgccacttccccgagtcccgaaac
agcagccacatcaagaggcccatgaacgccttcatggtgtgggccaaggatgagcggagg
aagatcctgcaagccttcccagacatgcacaactccagcatcagcaagatccttggatct
cgctggaagtccatgaccaaccaggagaagcagccctactatgaggaacaggcgcggctg
agccggcagcacctggagaagtatcctgactacaagtacaagccgcggcccaagcgcacc
tgcatcgtggagggcaagcggctgcgcgtgggagagtacaaggccctgatgaggacccgg
cgtcaggatgcccgccagagctacgtgatccccccgcaggctggccaggtgcagatgagc
tcctcagatgtcctgtaccctcgggcagcaggcatgccgctggcacagccactggtggag
cactatgtccctcgtagcctggaccccaacatgcctgtgatcgtcaacacctgcagcctc
agagaggagggtgagggcacagatgacaggcactcggtggctgatggcgagatgtaccgg
tacagcgaggacgaggactcggagggcgaagagaagagcgatggggagttggtggtgctc
acagactga

DBGET integrated database retrieval system