KEGG   Homo sapiens (human): 9582Help
Entry
9582              CDS       T01001                                 

Gene name
APOBEC3B, A3B, APOBEC1L, ARCD3, ARP4, DJ742C19.2, PHRBNL, bK150C2.2
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3B
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    9582 (APOBEC3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9582 (APOBEC3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     9582 (APOBEC3B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     9582 (APOBEC3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 dCMP_cyt_deam_1 Viral_Rep Toxin-deaminase
Motif
Other DBs
NCBI-GeneID: 9582
NCBI-ProteinID: NP_004891
OMIM: 607110
HGNC: 17352
Ensembl: ENSG00000179750
Vega: OTTHUMG00000151085
Pharos: Q9UH17(Tbio)
UniProt: Q9UH17
Structure
PDB: 

Position
22q13.1
AA seq 382 aa AA seqDB search
MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVY
FKPQYHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISA
ARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAF
LHRTLKEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCN
EAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQEN
THVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWDTFVYRQGCPFQPWD
GLEEHSQALSGRLRAILQNQGN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacagatcagaaatccgatggagcggatgtatcgagacacattctacgacaac
tttgaaaacgaacccatcctctatggtcggagctacacttggctgtgctatgaagtgaaa
ataaagaggggccgctcaaatctcctttgggacacaggggtctttcgaggccaggtgtat
ttcaagcctcagtaccacgcagaaatgtgcttcctctcttggttctgtggcaaccagctg
cctgcttacaagtgtttccagatcacctggtttgtatcctggaccccctgcccggactgt
gtggcgaagctggccgaattcctgtctgagcaccccaatgtcaccctgaccatctctgcc
gcccgcctctactactactgggaaagagattaccgaagggcgctctgcaggctgagtcag
gcaggagcccgcgtgacgatcatggactatgaagaatttgcatactgctgggaaaacttt
gtgtacaatgaaggtcagcaattcatgccttggtacaaattcgatgaaaattatgcattc
ctgcaccgcacgctaaaggagattctcagatacctgatggatccagacacattcactttc
aactttaataatgaccctttggtccttcgacggcgccagacctacttgtgctatgaggtg
gagcgcctggacaatggcacctgggtcctgatggaccagcacatgggctttctatgcaac
gaggctaagaatcttctctgtggcttttacggccgccatgcggagctgcgcttcttggac
ctggttccttctttgcagttggacccggcccagatctacagggtcacttggttcatctcc
tggagcccctgcttctcctggggctgtgccggggaagtgcgtgcgttccttcaggagaac
acacacgtgagactgcgcatcttcgctgcccgcatctatgattacgaccccctatataag
gaggcgctgcaaatgctgcgggatgctggggcccaagtctccatcatgacctacgatgag
tttgagtactgctgggacacctttgtgtaccgccagggatgtcccttccagccctgggat
ggactagaggagcacagccaagccctgagtgggaggctgcgggccattctccagaatcag
ggaaactga

DBGET integrated database retrieval system