KEGG   Homo sapiens (human): 9586Help
Entry
9586              CDS       T01001                                 

Gene name
CREB5, CRE-BPA, CREB-5
Definition
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing's syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington's disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    9586 (CREB5)
   04024 cAMP signaling pathway
    9586 (CREB5)
   04022 cGMP - PKG signaling pathway
    9586 (CREB5)
   04151 PI3K-Akt signaling pathway
    9586 (CREB5)
   04152 AMPK signaling pathway
    9586 (CREB5)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    9586 (CREB5)
   04922 Glucagon signaling pathway
    9586 (CREB5)
   04915 Estrogen signaling pathway
    9586 (CREB5)
   04926 Relaxin signaling pathway
    9586 (CREB5)
   04918 Thyroid hormone synthesis
    9586 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    9586 (CREB5)
   04925 Aldosterone synthesis and secretion
    9586 (CREB5)
   04927 Cortisol synthesis and secretion
    9586 (CREB5)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    9586 (CREB5)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    9586 (CREB5)
  Nervous system
   04725 Cholinergic synapse
    9586 (CREB5)
   04728 Dopaminergic synapse
    9586 (CREB5)
  Aging
   04211 Longevity regulating pathway - mammal
    9586 (CREB5)
  Environmental adaptation
   04714 Thermogenesis
    9586 (CREB5)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    9586 (CREB5)
   05215 Prostate cancer
    9586 (CREB5)
  Neurodegenerative diseases
   05016 Huntington's disease
    9586 (CREB5)
  Substance dependence
   05030 Cocaine addiction
    9586 (CREB5)
   05031 Amphetamine addiction
    9586 (CREB5)
   05034 Alcoholism
    9586 (CREB5)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    9586 (CREB5)
   04934 Cushing's syndrome
    9586 (CREB5)
  Infectious diseases
   05161 Hepatitis B
    9586 (CREB5)
   05165 Human papillomavirus infection
    9586 (CREB5)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    9586 (CREB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 GIT_CC DUF3874 DivIC
Motif
Other DBs
NCBI-GeneID: 9586
NCBI-ProteinID: NP_878901
HGNC: 16844
Ensembl: ENSG00000146592
Vega: OTTHUMG00000097081
Pharos: Q02930(Tbio)
UniProt: Q02930
Position
7p15.1
AA seq 508 aa AA seqDB search
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
RLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSVSEVVGSSTLSQLTTHRTDLNPIL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaggaatccaagatgaatttggagcaggagaggccgtttgtctgcagtgcc
ccaggctgctcccagcgcttcccaacagaggaccatctgatgattcataggcacaaacat
gaaatgactttgaagtttccttcaataaaaacagacaatatgttatcagatcaaactccg
accccaacgagattcctgaagaactgcgaggaggtgggcctcttcagcgagctggactgc
tccctggagcacgagttcaggaaggctcaggaagaggagagcagcaagcggaatatctcg
atgcataatgcagttggtggggccatgacggggcccggaactcaccagcttagcagcgct
cggctgcccaaccatgacaccaacgttgtgattcagcaagccatgccgtcgcctcagtcc
agctctgtcatcactcaggcaccttccaccaaccgccagatcgggcctgtcccaggctct
ctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatgcct
gggaccctgcccaaccctacaatgccaggatcttccgccgtcttgatgccaatggagcga
caaatgtcagtgaactccagcatcatggggatgcaaggtccaaatctcagcaacccctgt
gcttctccccaggtccagccaatgcattcagaagccaaaatgaggttgaaggctgcattg
actcaccaccctgctgccatgtcaaatgggaacatgaacaccatgggacacatgatggag
atgatgggctcccggcaggaccagacgccacaccatcacatgcactcgcacccgcatcag
caccagacactgccaccccatcacccttacccacaccagcaccagcacccagcacaccat
cctcaccctcaaccccatcaccagcagaaccatccacatcaccactcccattcccacctt
catgcacacccagcacatcaccagacctcgccacatccgcccctgcacaccggcaaccaa
gcacaggtttcaccagcaacacaacagatgcagccaacccagacaatacagccaccccag
cccacaggggggcgccggcgaagggtggtagacgaggatccggacgagaggcggcggaaa
tttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgggtg
atgtcattggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaatgaa
gtgtctatgttgaaaaatgaggtggcccagctgaaacagttgttgttaacacataaagac
tgcccaataacagccatgcagaaagaatcacaaggatatctaagtccagagagtagccct
cctgctagtcctgtcccagcttgctcccagcaacaagtcatccagcataataccatcact
acttcctcatcggtcagcgaggtggtaggaagctccaccctcagccagctcaccactcac
agaacagacctgaatccgattctttaa

DBGET integrated database retrieval system