KEGG   Homo sapiens (human): 9589
Entry
9589              CDS       T01001                                 

Gene name
WTAP, Mum2
Definition
(RefSeq) WT1 associated protein
  KO
K22824  pre-mRNA-splicing regulator WTAP
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9589 (WTAP)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     9589 (WTAP)
Motif
Pfam: Wtap SPACA9 ADIP
Other DBs
NCBI-GeneID: 9589
NCBI-ProteinID: NP_001257460
OMIM: 605442
HGNC: 16846
Ensembl: ENSG00000146457
Vega: OTTHUMG00000015933
Pharos: Q15007(Tbio)
UniProt: Q15007
Position
6q25.3
AA seq 396 aa
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE
KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLF
FLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRI
AQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQ
QQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGSSSRQRTSGSGFHREGNTTE
DDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSH
DPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaccaacgaagaacctcttcccaagaaggttcgattgagtgaaacagacttcaaagtt
atggcaagagatgagttaattctaagatggaaacaatatgaagcatatgtacaagctttg
gagggcaagtacacagatcttaactctaatgatgtaactggcctaagagagtctgaagaa
aaactaaagcaacaacagcaggagtctgcacgcagggaaaacatccttgtaatgcgacta
gcaaccaaggaacaagagatgcaagagtgtactactcaaatccagtacctcaagcaagtc
cagcagccgagcgttgcccaactgagatcaacaatggtagacccagcgatcaacttgttt
ttcctaaaaatgaaaggtgaactggaacagactaaagacaaactggaacaagcccaaaat
gaactgagtgcctggaagtttacgcctgatagccaaacagggaaaaagttaatggcgaag
tgtcgaatgcttatccaggagaatcaagagcttggaaggcagctgtcccagggacgtatt
gcacaacttgaagcagagttggctttacagaagaaatacagtgaggagcttaaaagcagt
caggatgaactgaatgacttcatcatccagcttgatgaagaagtagagggtatgcagagt
accattctagttctgcagcagcagctgaaggagacacgccagcagttggctcagtaccag
cagcagcagtctcaggcctctgccccaagtaccagcaggactacagcttctgaacctgta
gaacagtcagaggccacaagtaaagactgcagtcgtctgacaaacggaccaagtaatggt
agctcctcccgccagaggacgtctgggtctggatttcacagggagggcaacacaaccgaa
gatgactttccttcttctccagggaatggtaataagtcctccaacagctcagaggagaga
actggcagaggaggtagtggttacgtaaatcaactcagtgcggggtatgaaagtgtagac
tctcccacgggcagtgaaaactctctcacacaccaatcaaatgacacagactccagtcat
gaccctcaagaggagaaagcagtgagtgggaaaggtaatcgaactgtgggttcccgccac
gttcagaatggcttggactcaagtgtaaatgtacagggttcagttttgtaa

DBGET integrated database retrieval system