KEGG   Homo sapiens (human): 959Help
Entry
959               CDS       T01001                                 

Gene name
CD40LG, CD154, CD40L, HIGM1, IGM, IMD3, T-BAM, TNFSF5, TRAP, gp39, hCD40L
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05330  Allograft rejection
hsa05340  Primary immunodeficiency
hsa05416  Viral myocarditis
Network
nt06123  TNF signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06223  TNF-NFKB signaling
  Element
N00505  CD40-NFKB signaling pathway
Disease
H00093  Combined immunodeficiency
Drug target
Letolizumab: D11122
Ruplizumab: D05777
Toralizumab: D06193
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    959 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    959 (CD40LG)
   04514 Cell adhesion molecules (CAMs)
    959 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    959 (CD40LG)
   04672 Intestinal immune network for IgA production
    959 (CD40LG)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    959 (CD40LG)
   05322 Systemic lupus erythematosus
    959 (CD40LG)
   05320 Autoimmune thyroid disease
    959 (CD40LG)
   05330 Allograft rejection
    959 (CD40LG)
   05340 Primary immunodeficiency
    959 (CD40LG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    959 (CD40LG)
  09174 Infectious disease: parasitic
   05144 Malaria
    959 (CD40LG)
   05145 Toxoplasmosis
    959 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    959 (CD40LG)
   04090 CD molecules [BR:hsa04090]
    959 (CD40LG)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   959 (CD40LG)
CD molecules [BR:hsa04090]
 Proteins
  959 (CD40LG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 959
NCBI-ProteinID: NP_000065
OMIM: 300386
HGNC: 11935
Ensembl: ENSG00000102245
Vega: OTTHUMG00000022512
Pharos: P29965(Tbio)
UniProt: P29965
Structure
PDB: 

Position
Xq26.3
AA seq 261 aa AA seqDB search
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacatacaaccaaacttctccccgatctgcggccactggactgcccatcagc
atgaaaatttttatgtatttacttactgtttttcttatcacccagatgattgggtcagca
ctttttgctgtgtatcttcatagaaggttggacaagatagaagatgaaaggaatcttcat
gaagattttgtattcatgaaaacgatacagagatgcaacacaggagaaagatccttatcc
ttactgaactgtgaggagattaaaagccagtttgaaggctttgtgaaggatataatgtta
aacaaagaggagacgaagaaagaaaacagctttgaaatgcaaaaaggtgatcagaatcct
caaattgcggcacatgtcataagtgaggccagcagtaaaacaacatctgtgttacagtgg
gctgaaaaaggatactacaccatgagcaacaacttggtaaccctggaaaatgggaaacag
ctgaccgttaaaagacaaggactctattatatctatgcccaagtcaccttctgttccaat
cgggaagcttcgagtcaagctccatttatagccagcctctgcctaaagtcccccggtaga
ttcgagagaatcttactcagagctgcaaatacccacagttccgccaaaccttgcgggcaa
caatccattcacttgggaggagtatttgaattgcaaccaggtgcttcggtgtttgtcaat
gtgactgatccaagccaagtgagccatggcactggcttcacgtcctttggcttactcaaa
ctctga

DBGET integrated database retrieval system