KEGG   Homo sapiens (human): 9590Help
Entry
9590              CDS       T01001                                 

Gene name
AKAP12, AKAP250, SSeCKS
Definition
(RefSeq) A-kinase anchoring protein 12
  KO
K16528  A-kinase anchor protein 12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    9590 (AKAP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WSK RII_binding_1
Motif
Other DBs
NCBI-GeneID: 9590
NCBI-ProteinID: NP_005091
OMIM: 604698
HGNC: 370
Ensembl: ENSG00000131016
Vega: OTTHUMG00000015833
Pharos: Q02952(Tbio)
UniProt: Q02952 Q86TJ9
Position
6q25.1
AA seq 1782 aa AA seqDB search
MGAGSSTEQRSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPATKLLQKNG
QLSTINGVAEQDELSLQEGDLNGQKGALNGQGALNSQEEEEVIVTEVGQRDSEDVSKRDS
DKEMATKSAVVHDITDDGQEETPEIIEQIPSSESNLEELTQPTESQANDIGFKKVFKFVG
FKFTVKKDKTEKPDTVQLLTVKKDEGEGAAGAGDHKDPSLGAGEAASKESEPKQSTEKPE
ETLKREQSHAEISPPAESGQAVEECKEEGEEKQEKEPSKSAESPTSPVTSETGSTFKKFF
TQGWAGWRKKTSFRKPKEDEVEASEKKKEQEPEKVDTEEDGKAEVASEKLTASEQAHPQE
PAESAHEPRLSAEYEKVELPSEEQVSGSQGPSEEKPAPLATEVFDEKIEVHQEEVVAEVH
VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGA
DLSPDEKVLSKPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGG
DEESGEHTQVPADSPDSQEEQKGESSASSPEEPEEITCLEKGLAEVQQDGEAEEGATSDG
EKKREGVTPWASFKKMVTPKKRVRRPSESDKEDELDKVKSATLSSTESTASEMQEEMKGS
VEEPKPEEPKRKVDTSVSWEALICVGSSKKRARRGSSSDEEGGPKAMGGDHQKADEAGKD
KETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFKRLVTPRKKSKSKLEEKS
EDSIAGSGVEHSTPDTEPGKEESWVSIKKFIPGRRKKRPDGKQEQAPVEDAGPTGANEDD
SDVPAVVPLSEYDAVEREKMEAQQAQKSAEQPEQKAATEVSKELSESQVHMMAAAVADGT
RAATIIEERSPSWISASVTEPLEQVEAEAALLTEEVLEREVIAEEEPPTVTEPLPENREA
RGDTVVSEAELTPEAVTAAETAGPLGAEEGTEASAAEETTEMVSAVSQLTDSPDTTEEAT
PVQEVEGGVPDIEEQERRTQEVLQAVAEKVKEESQLPGTGGPEDVLQPVQRAEAERPEEQ
AEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQ
AETLAGVKSQEMVMEQAIPPDSVETPTDSETDGSTPVADFDAPGTTQKDEIVEIHEENEV
ASGTQSGGTEAEAVPAQKERPPAPSSFVFQEETKEQSKMEDTLEHTDKEVSVETVSILSK
TEGTQEADQYADEKTKDVPFFEGLEGSIDTGITVSREKVTEVALKGEGTEEAECKKDDAL
ELQSHAKSPPSPVEREMVVQVEREKTEAEPTHVNEEKLEHETAVTVSEEVSKQLLQTVNV
PIIDGAKEVSSLEGSPPPCLGQEEAVCTKIQVQSSEASFTLTAAAEEEKVLGETANILET
GETLEPAGAHLVLEEKSSEKNEDFAAHPGEDAVPTGPDCQAKSTPVIVSATTKKGLSSDL
EGEKTTSLKWKSDEVDEQVACQEVKVSVAIEDLEPENGILELETKSSKLVQNIIQTAVDQ
FVRTEETATEMLTSELQTQAHVIKADSQDAGQETEKEGEEPQASAQDETPITSAKEESES
TAVGQAHSDISKDMSEASEKTMTVEVEGSTVNDQQLEEVVLPSEEEGGGAGTKSVPEDDG
HALLAERIEKSLVEPKEDEKGDDVDDPENQNSALADTDASGGLTKESPDTNGPKQKEKED
AQEVELQEGKVHSESDKAITPQAQEELQKQERESAKSELTES
NT seq 5349 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggagctccaccgagcagcgcagcccggagcagccgcccgaggggagctcc
acgccggctgagcccgagcccagcggcggcggcccctcggccgaggcggcgccagacacc
accgcggaccccgccatcgctgcctcggaccccgccaccaagctcctacagaagaatggt
cagctgtccaccatcaatggcgtagctgagcaagatgagctcagcctccaggagggtgac
ctaaatggccagaaaggagccctgaacggtcaaggagccctaaacagccaggaggaagaa
gaagtcattgtcacagaggttggacagagagactctgaagatgtgagcaaaagagactcc
gataaagagatggctactaagtcagcggttgttcacgacatcacagatgatgggcaggag
gagacacccgaaataatcgaacagattccttcttcagaaagcaatttagaagagctaaca
caacccactgagtcccaggctaatgatattggatttaagaaggtgtttaagtttgttggc
tttaaattcactgtgaaaaaggataagacagagaagcctgacactgtccagctactcact
gtgaagaaagatgaaggggagggagcagcaggggctggcgaccacaaggaccccagcctt
ggggctggagaagcagcatccaaagaaagcgaacccaaacaatctacagagaaacccgaa
gagaccctgaagcgtgagcaaagccacgcagaaatttctcccccagccgaatctggccaa
gcagtggaggaatgcaaagaggaaggagaagagaaacaagaaaaagaacctagcaagtct
gcagaatctccgactagtcccgtgaccagtgaaacaggatcaaccttcaaaaaattcttc
actcaaggttgggccggctggcgcaaaaagaccagtttcaggaagccgaaggaggatgaa
gtggaagcttcagagaagaaaaaggaacaagagccagaaaaagtagacacagaagaagac
ggaaaggcagaggttgcctccgagaaactgaccgcctccgagcaagcccacccacaggag
ccggcagaaagtgcccacgagccccggttatcagctgaatatgagaaagttgagctgccc
tcagaggagcaagtcagtggctcgcagggaccttctgaagagaaacctgctccgttggcg
acagaagtgtttgatgagaaaatagaagtccaccaagaagaggttgtggccgaagtccac
gtcagcaccgtggaggagagaaccgaagagcagaaaacggaggtggaagaaacagcaggg
tctgtgccagctgaagaattggttgaaatggatgcagaacctcaggaagctgaacctgcc
aaggagctggtgaagctcaaagaaacgtgtgtttccggagaggaccctacacagggagct
gacctcagtcctgatgagaaggtgctgtccaaaccccccgaaggcgttgtgagtgaggtg
gaaatgctgtcatcacaggagagaatgaaggtgcagggaagtccactaaagaagcttttt
accagcactggcttaaaaaagctttctggaaagaaacagaaagggaaaagaggaggagga
gacgaggaatcaggggagcacactcaggttccagccgattctccggacagccaggaggag
caaaagggcgagagctctgcctcatcccctgaggagcccgaggagatcacgtgtctggaa
aagggcttagccgaggtgcagcaggatggggaagctgaagaaggagctacttccgatgga
gagaaaaaaagagaaggtgtcactccctgggcatcattcaaaaagatggtgacgcccaag
aagcgtgttagacggccttcggaaagtgataaagaagatgagctggacaaggtcaagagc
gctaccttgtcttccaccgagagcacagcctctgaaatgcaagaagaaatgaaagggagc
gtggaagagccaaagccggaagaaccaaagcgcaaggtggatacctcagtatcttgggaa
gctttaatttgtgtgggatcatccaagaaaagagcaaggagagggtcctcttctgatgag
gaagggggaccaaaagcaatgggaggagaccaccagaaagctgatgaggccggaaaagac
aaagagacggggacagacgggatccttgctggttcccaagaacatgatccagggcaggga
agttcctccccggagcaagctggaagccctaccgaaggggagggcgtttccacctgggag
tcatttaaaaggttagtcacgccaagaaaaaaatcaaagtccaagctggaagagaaaagc
gaagactccatagctgggtctggtgtagaacattccactccagacactgaacccggtaaa
gaagaatcctgggtctcaatcaagaagtttattcctggacgaaggaagaaaaggccagat
gggaaacaagaacaagcccctgttgaagacgcagggccaacaggggccaacgaagatgac
tctgatgtcccggccgtggtccctctgtctgagtatgatgctgtagaaagggagaaaatg
gaggcacagcaagcccaaaaaagcgcagagcagcccgagcagaaggcagccactgaggtg
tccaaggagctcagcgagagtcaggttcatatgatggcagcagctgtcgctgacgggacg
agggcagctaccattattgaagaaaggtctccttcttggatatctgcttcagtgacagaa
cctcttgaacaagtagaagctgaagccgcactgttaactgaggaggtattggaaagagaa
gtaattgcagaagaagaaccccccacggttactgaacctctgccagagaacagagaggcc
cggggcgacacggtcgttagtgaggcggaattgacccccgaagctgtgacagctgcagaa
actgcagggccattgggtgccgaagaaggaaccgaagcatctgctgctgaagagaccaca
gaaatggtgtcagcagtctcccagttaaccgactccccagacaccacagaggaggccact
ccggtgcaggaggtggaaggtggcgtacctgacatagaagagcaagagaggcggactcaa
gaggtcctccaggcagtggcagaaaaagtgaaagaggaatcccagctgcctggcaccggt
gggccagaagatgtgcttcagcctgtgcagagagcagaggcagaaagaccagaagagcag
gctgaagcgtcgggtctgaagaaagagacggatgtagtgttgaaagtagatgctcaggag
gcaaaaactgagccttttacacaagggaaggtggtggggcagaccaccccagaaagcttt
gaaaaagctcctcaagtcacagagagcatagagtccagtgagcttgtaaccacttgtcaa
gccgaaaccttagctggggtaaaatcacaggagatggtgatggaacaggctatcccccct
gactcggtggaaacccctacagacagtgagactgatggaagcacccccgtagccgacttt
gacgcaccaggcacaacccagaaagacgagattgtggaaatccatgaggagaatgaggtc
gcatctggtacccagtcagggggcacagaagcagaggcagttcctgcacagaaagagagg
cctccagcaccttccagttttgtgttccaggaagaaactaaagaacaatcaaagatggaa
gacactctagagcatacagataaagaggtgtcagtggaaactgtatccattctgtcaaag
actgaggggactcaagaggctgaccagtatgctgatgagaaaaccaaagacgtaccattt
ttcgaaggacttgaggggtctatagacacaggcataacagtcagtcgggaaaaggtcact
gaagttgcccttaaaggtgaagggacagaagaagctgaatgtaaaaaggatgatgctctt
gaactgcagagtcacgctaagtctcctccatcccccgtggagagagagatggtagttcaa
gtcgaaagggagaaaacagaagcagagccaacccatgtgaatgaagagaagcttgagcac
gaaacagctgttaccgtatctgaagaggtcagtaagcagctcctccagacagtgaatgtg
cccatcatagatggggcaaaggaagtcagcagtttggaaggaagccctcctccctgccta
ggtcaagaggaggcagtatgcaccaaaattcaagttcagagctctgaggcatcattcact
ctaacagcggctgcagaggaggaaaaggtcttaggagaaactgccaacattttagaaaca
ggtgaaacgttggagcctgcaggtgcacatttagttctggaagagaaatcctctgaaaaa
aatgaagactttgccgctcatccaggggaagatgctgtgcccacagggcccgactgtcag
gcaaaatcgacaccagtgatagtatctgctactaccaagaaaggcttaagttccgacctg
gaaggagagaaaaccacatcactgaagtggaagtcagatgaagtcgatgagcaggttgct
tgccaggaggtcaaagtgagtgtagcaattgaggatttagagcctgaaaatgggattttg
gaacttgagaccaaaagcagtaaacttgtccaaaacatcatccagacagccgttgaccag
tttgtacgtacagaagaaacagccaccgaaatgttgacgtctgagttacagacacaagct
cacgtgataaaagctgacagccaggacgctggacaggaaacggagaaagaaggagaggaa
cctcaggcctctgcacaggatgaaacaccaattacttcagccaaagaggagtcagagtca
accgcagtgggacaagcacattctgatatttccaaagacatgagtgaagcctcagaaaag
accatgactgttgaggtagaaggttccactgtaaatgatcagcagctggaagaggtcgtc
ctcccatctgaggaagagggaggtggagctggaacaaagtctgtgccagaagatgatggt
catgccttgttagcagaaagaatagagaagtcactagttgaaccgaaagaagatgaaaaa
ggtgatgatgttgatgaccctgaaaaccagaactcagccctggctgatactgatgcctca
ggaggcttaaccaaagagtccccagatacaaatggaccaaaacaaaaagagaaggaggat
gcccaggaagtagaattgcaggaaggaaaagtgcacagtgaatcagataaagcgatcaca
ccccaagcacaggaggagttacagaaacaagagagagaatctgcaaagtcagaacttaca
gaatcttaa

DBGET integrated database retrieval system