KEGG   Homo sapiens (human): 9604
Entry
9604              CDS       T01001                                 
Symbol
RNF14, ARA54, HFB30, HRIHFB2038, TRIAD2
Name
(RefSeq) ring finger protein 14
  KO
K11971  E3 ubiquitin-protein ligase RNF14 [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9604 (RNF14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     9604 (RNF14)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    9604 (RNF14)
SSDB
Motif
Pfam: RWD IBR zf-RING_2 zf-RING_5 T5orf172 TBPIP
Other DBs
NCBI-GeneID: 9604
NCBI-ProteinID: NP_001188294
OMIM: 605675
HGNC: 10058
Ensembl: ENSG00000013561
Pharos: Q9UBS8(Tbio)
UniProt: Q9UBS8
Position
5:141949337..141990292
AA seq 474 aa
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQN
SGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGS
VVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQE
EIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRH
VYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSL
DLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDL
RNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKM
TCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtcgtcagaagatcgagaagctcaggaggatgaattgctggccctggcaagtatttac
gatggagatgaatttagaaaagcagagtctgtccaaggtggagaaaccaggatctatttg
gatttgccacagaatttcaagatatttgtgagcggcaattcaaatgagtgtctccagaat
agtggctttgaatacaccatttgctttctgcctccacttgtgctgaactttgaactgcca
ccagattatccatcctcttccccaccttcattcacacttagtggcaaatggctgtcacca
actcagctatctgctctatgcaagcacttagacaacctatgggaagaacaccgtggcagc
gtggtcctgtttgcctggatgcaatttcttaaggaagagaccctagcatacttgaatatt
gtctctccttttgagctcaagattggttctcagaaaaaagtgcagagaaggacagctcaa
gcttctcccaacacagagctagattttggaggagctgctggatctgatgtagaccaagag
gaaattgtggatgagagagcagtgcaggatgtggaatcactgtcaaatctgatccaggaa
atcttggactttgatcaagctcagcagataaaatgctttaatagtaaattgttcctgtgc
agtatctgtttctgtgagaagctgggtagtgaatgcatgtacttcttggagtgcaggcat
gtgtactgcaaagcctgtctgaaggactactttgaaatccagatcagagatggccaggtt
caatgcctcaactgcccagaaccaaagtgcccttcggtggccactcctggtcaggtcaaa
gagttagtggaagcagagttatttgcccgttatgaccgccttctcctccagtcctccttg
gacctgatggcagatgtggtgtactgcccccggccgtgctgccagctgcctgtgatgcag
gaacctggctgcaccatgggtatctgctccagctgcaattttgccttctgtactttgtgc
aggttgacctaccatggggtctccccatgtaaggtgactgcagagaaattaatggactta
cgaaatgaatacctgcaagcggatgaggctaataaaagacttttggatcaaaggtatggt
aagagagtgattcagaaggcactggaagagatggaaagtaaggagtggctagagaagaac
tcaaagagctgcccatgttgtggaactcccatagagaaattagacggatgtaacaagatg
acatgtactggctgtatgcaatatttctgttggatttgcatgggttctctctctagagca
aacccttacaaacatttcaatgaccctggttcaccatgttttaaccggctgttttatgct
gtggatgttgacgacgatatttgggaagatgaggtagaagactag

DBGET integrated database retrieval system