KEGG   Homo sapiens (human): 9611Help
Entry
9611              CDS       T01001                                 

Gene name
NCOR1, N-CoR, N-CoR1, PPP1R109, TRAC1, hN-CoR
Definition
(RefSeq) nuclear receptor corepressor 1
  KO
K04650  nuclear receptor co-repressor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04919  Thyroid hormone signaling pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00118  TEL-AML1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9611 (NCOR1)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    9611 (NCOR1)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    9611 (NCOR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9611 (NCOR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9611 (NCOR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 9611
NCBI-ProteinID: NP_006302
OMIM: 600849
HGNC: 7672
Ensembl: ENSG00000141027
Vega: OTTHUMG00000059309
Pharos: O75376(Tchem)
UniProt: O75376 A0A024RD47
Structure
PDB: 

Position
17p12-p11.2
AA seq 2440 aa AA seqDB search
MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQ
QQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQ
RVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEE
LIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY
DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR
KQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ
RVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM
NGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYL
TKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDE
KEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAA
AAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEA
QCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEE
ENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESV
ETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDN
TKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFP
MDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALY
QRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPE
GVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPK
PSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQ
EGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKG
REEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSM
RESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKR
ESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEG
SISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKA
GETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMN
RTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVY
RSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITS
QQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITY
IPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRP
GSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPA
GGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAV
SEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELR
TRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPAS
SPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMG
QVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNR
YSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHE
KQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSG
GGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVE
DHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIP
GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTP
IACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD
NT seq 7323 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagttcaggttatcctcccaaccaaggagcattcagcacagaacaaagtcgttat
cctcctcactctgtccagtatacatttcccaacacccgccaccagcaggagttcgcagtc
cctgattatcgttcctctcatcttgaagtgagtcaggcatcacagcttttgcagcaacag
cagcagcaacagcttcgaaggcgaccttccttgctttcagaatttcacccaggttctgac
aggcctcaagaaaggagaactagttatgaaccgtttcatccaggcccatccccagtggat
catgattcactggaatcgaagcgaccacgtctggaacaggtttctgattctcattttcag
cgtgtcagtgctgcggttttgcctttagtgcacccgctgccagaagggctgagggcttct
gcagatgctaagaaggatccagcattcggaggcaaacatgaagctccatcctctccaatt
tcggggcaaccatgtggagatgatcaaaatgcttcaccttcaaaactctcaaaggaagag
ttaatacagagtatggatcgtgtagatcgagaaattgcaaaagtagaacagcagatcctt
aaactgaaaaagaaacaacaacagcttgaagaagaggcagctaaacctcctgagcctgag
aagcccgtgtcccctcctcctgtggagcagaaacaccgcagtattgtccaaattatttat
gatgagaatcggaaaaaagcagaagaagctcataaaatttttgaaggtcttggcccaaaa
gttgaactgccactgtataaccagccatcagataccaaggtgtaccatgagaacatcaag
acaaaccaggtgatgaggaaaaaactcattttattttttaaaagaagaaatcatgcaaga
aaacaaagggaacaaaaaatctgccagcgttatgatcagctcatggaggcatgggagaaa
aaagtggacagaatagaaaataatcctcggaggaaagctaaagaaagcaaaacaagggaa
tactatgaaaagcagtttccagaaattcgaaaacaaagagaacagcaagaaagatttcag
cgagttgggcagaggggagctggtctttcagccaccattgctaggagtgagcatgagatt
tctgaaattattgatgggctctctgagcaggagaataatgagaaacaaatgcggcagctc
tctgtgattccacctatgatgtttgatgcagaacaaagacgagtcaagttcattaacatg
aatgggcttatggaggaccctatgaaagtgtataaagataggcagtttatgaatgtttgg
actgaccatgaaaaggagatctttaaggacaagtttatccagcatccaaaaaactttgga
ctaattgcatcatacttggagaggaagagtgttcctgattgtgttttgtattactattta
accaagaaaaatgagaattataaagccctcgtcagaaggaattatgggaaacgcagaggc
agaaaccagcaaattgctcgaccctcgcaagaagaaaaagtagaagaaaaagaagaggat
aaagcagaaaaaacagaaaaaaaagaagaagaaaagaaagatgaagaggaaaaagatgaa
aaagaagactccaaagaaaataccaaggaaaaggacaagatagatggtacagcagaagaa
actgaggaaagagagcaagccacaccccgggggcgaaagactgccaacagtcagggccgc
cgtaagggccggatcaccaggtccatgacaaacgaagctgcagctgccagtgctgcagcc
gcagcggctactgaagagcccccaccacctctgccaccgccaccagaacccatttctaca
gagcctgtggagacctctcgatggacagaagaagaaatggaagttgctaaaaaaggtcta
gtagaacatggtcgtaactgggcagcaattgctaaaatggtgggaacgaaaagtgaagct
caatgtaaaaacttctattttaactataaaaggcgacacaatcttgacaacctcttacag
cagcataaacagaaaacttcacgaaaacctcgtgaagagcgagatgtgtctcaatgtgaa
agtgtcgcttccactgtttctgctcaggaggatgaagatattgaagcctccaatgaagaa
gaaaatccagaagacagcgaagttgaagctgtcaagcccagcgaggacagtcctgaaaat
gctacttctcgaggaaacacagaacctgcggttgagcttgagcccaccacggaaactgca
cccagtacatctccctccttagcagttccaagtacaaaaccagctgaagatgaaagtgtg
gagacccaggtgaatgacagcatcagtgctgagacagcagagcagatggatgtagatcag
caggagcacagtgctgaagagggttctgtttgtgatcccccacccgctaccaaagctgac
tctgtggacgttgaagtgagggtgccagaaaaccatgcatctaaagttgaaggtgataat
accaaagaaagagacttggatagagccagtgagaaggtggaacctagagatgaagatttg
gtggtagctcagcaaataaatgcccaaaggcccgagccccagtcagacaatgattccagt
gccacgtgcagcgctgatgaggatgtggatggagagccagagaggcagagaatgtttcct
atggactcaaagccttcactgttaaaccccactggatctatactcgtctcatctccgtta
aaaccaaatccactggatctgccacagcttcagcatcgagctgctgttatcccaccaatg
gtatcctgcaccccatgtaacataccaattggaaccccagtgagcggctatgctctctac
cagcgacacattaaagcaatgcatgagtcagcactcctggaggagcagcggcagagacaa
gaacagatagatttggaatgtagaagttctacaagtccatgtggcacatccaagagtcca
aacagagagtgggaagtccttcagcctgctccacatcaagtgataactaatctccctgaa
ggcgttcggcttccgacaactcgaccaaccaggccaccgccccctctcatcccgtcatcc
aaaaccacagtggcttcagaaaaaccatcttttataatgggaggctccatctcacaggga
acaccaggcacttatttgacttctcataatcaggcttcctacactcaagaaacacccaag
ccgtcagtgggatctatctctcttggactgccacggcaacaggaatctgccaaatcagct
actttgccctacatcaagcaggaagaattttctccccgaagccaaaactcacaacctgag
ggtctgttggtcagggcccaacatgaaggtgtagtcagaggtaccgcaggagccatacaa
gaaggaagtataactcggggaactccaaccagcaaaatttcagtggagagcattccatcc
ctacggggctctatcactcagggcaccccggctctgccccagactggcataccaacagag
gctttggtgaaggggtccatttcgagaatgcccattgaagacagcagtcctgagaaaggc
agagaggaagctgcatccaaaggccatgttatttatgaaggcaaaagtggacatatcttg
tcatatgataatattaagaatgcccgagaagggactaggagtccaagaacagctcatgaa
atcagtttaaagagaagctatgaatcagtggaaggaaatataaagcaagggatgtcaatg
agggagtctcctgtatcagcaccgttagaggggctgatatgccgagcattacccaggggg
agtcctcattctgacctcaaagaaaggactgtattgtctggctccataatgcaggggaca
ccaagagcaacaactgaaagctttgaagatggccttaaatatcccaaacaaattaaaagg
gaaagtcctcccatacgagcatttgaaggtgccattaccaaaggaaaaccatatgatggc
atcaccaccatcaaagaaatggggcgttccattcatgagattccaaggcaagatatttta
actcaggaaagtcggaaaactccagaagtggtccagagcacacggccgataattgagggt
tccatttcccagggcacaccaataaagtttgacaacaactcaggtcaatctgccatcaaa
cacaatgtcaaatccttaatcacggggcctagcaaactatcccgtggaatgcctccgctg
gaaattgtgccagagaacataaaagtggtagaacggggaaaatatgaggatgtgaaagca
ggcgagaccgtgcgttcccggcacacgtcagtggtaagctctggcccctccgttcttagg
tccacactgcatgaagctcccaaagcacaactgagccctgggatttatgatgacaccagt
gcacggaggacccctgtgagttatcaaaacaccatgtccagaggctcacccatgatgaac
agaacttctgatgttacaatttcttctaacaagtctaccaatcatgaaaggaaatcgaca
ctgacccctacccagagggaaagtatcccagcgaagtctccagtgcctggggtggaccct
gtcgtgagccacagtccgtttgatccccatcacagaggcagcactgcaggcgaggtttat
cggagccacctgcccacgcacttggatccagccatgccttttcacagggctttggatcct
gcagcggctgcttacctgtttcagagacagctttcaccaactccaggttacccaagtcag
tatcagctttacgcaatggagaacacaagacagacaatcttaaatgattacattacctca
caacagatgcaagtgaacttgcgtccagatgtggccagaggactctccccaagagagcag
ccactgggtctcccatacccagcaacgagaggaatcattgacctgaccaatatgcctcca
acaattttagtgcctcatccagggggaacaagcactcctcccatggacagaatcacttat
attcctggtacacagattactttccctcccaggccgtacaactctgcttccatgtctcca
ggacacccaacacaccttgcagctgctgcaagtgctgagagggaacgggaacgggagcgg
gagaaggagcgggagcgggaacggattgctgcagcttcctccgacctctacctgcggcca
ggctcagaacagcctggccgacctggcagtcatggatatgttcgctccccttccccttca
gtaagaactcaggagaccatgttgcaacagagacccagtgttttccaaggaaccaatgga
accagtgtaatcacacctttggatccaactgctcagctacgaatcatgccactgcctgct
gggggcccttcaataagccaaggcctgccagcctcccgttacaacactgctgcggatgcc
ctggctgctcttgtggatgctgcagcttctgcaccccagatggatgtgtccaaaacaaaa
gagagtaagcatgaagctgccaggttagaagaaaatttgagaagcaggtcagcagcagtt
agtgaacagcagcagctagagcagaaaaccctggaggtggagaagagatctgttcagtgt
ttatacacttcttcagcctttccaagtggcaagccccagcctcattcttcagtagtttat
tctgaggctgggaaagataaagggcctcctccaaaatccagatatgaggaagagctaagg
accagagggaagactaccattactgcagctaacttcatagacgtgatcatcacccggcaa
attgcctcggacaaggatgcgagggaacgtggctctcaaagttcagactcttctagtagc
ttatcttctcacaggtatgaaacacctagcgatgctattgaggtgataagtcctgccagc
tcacctgcgccaccccaggagaaactgcagacctatcagccagaggttgttaaggcaaat
caagcggaaaatgatcctaccagacaatatgaaggaccattacatcactatcgaccacag
caggaatcaccatctccccaacaacagctgcccccttcttcacaggcagagggaatgggg
caagtgcccaggacccatcggctgatcacacttgctgatcacatctgtcaaattatcaca
caagattttgctagaaatcaagtttcctcgcagactccccagcagcctcctacttctaca
ttccagaactcaccttctgctttggtatctacacctgtgaggactaaaacatcaaaccgt
tacagcccagaatcccaggctcagtctgtccatcatcaaagaccaggttcaagggtctct
ccagaaaatcttgtggacaaatccaggggaagtaggcctggaaaatccccagagaggagt
cacgtctcttcggagccctacgagcccatctccccaccccaggttccggttgtgcatgag
aaacaggacagcttgctgctcttgtctcagaggggcgcagagcctgcagagcagaggaat
gatgcccgctcaccagggagtataagctacttgccttcattcttcaccaagcttgaaaat
acatcacccatggttaaatcaaagaagcaggagatttttcgtaagttgaactcctctggt
ggaggtgactctgatatggcagctgctcagccaggaactgagatctttaatctgccagca
gttactacgtcaggctcagttagctctagaggccattcttttgctgatcctgccagtaat
cttgggctggaagacattatcaggaaggctctcatgggaagctttgatgacaaagttgag
gatcatggagttgtcatgtcccagcctatgggagtagtgcctggtactgccaacacctca
gttgtgaccagtggtgagacacgaagagaggaaggggacccatcacctcattcaggagga
gtttgcaaaccaaagctgatcagcaagtcaaacagcaggaaatctaagtctcctatacct
gggcaaggctacttaggaacggaacggccctcttcagtctcctctgtacattcagaaggg
gattaccataggcagacgccagggtgggcctgggaagacaggccctcttcaacaggctca
actcagtttccttataaccctctgactatgcggatgctcagcagtactccaccaacaccg
attgcatgtgctccctctgcggtgaaccaagcagctcctcaccaacagaacaggatctgg
gagcgagagcctgccccactgctctcagcacagtacgagaccctgtcggatagtgatgac
tga

DBGET integrated database retrieval system