KEGG   Homo sapiens (human): 9619Help
Entry
9619              CDS       T01001                                 

Gene name
ABCG1, ABC8, WHITE1
Definition
(RefSeq) ATP binding cassette subfamily G member 1
  KO
K05679  ATP-binding cassette, subfamily G (WHITE), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    9619 (ABCG1)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCG (White) subfamily
   ABCG1, 4 subgroups
    9619 (ABCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane ABC_tran SMC_N AAA_21 RsgA_GTPase AAA_29 AAA_16 MMR_HSR1 AAA_13 cobW AAA_23 AAA_18 AAA_28 AAA_22 AAA_30 Cytidylate_kin
Motif
Other DBs
NCBI-GeneID: 9619
NCBI-ProteinID: NP_004906
OMIM: 603076
HGNC: 73
Ensembl: ENSG00000160179
Vega: OTTHUMG00000086791
Pharos: P45844(Tbio)
UniProt: P45844
Position
21q22.3
AA seq 678 aa AA seqDB search
MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNL
TEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPS
GAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMV
SAHLKLQEKDEGRREMVKEILTALGLLSCANTRTGSLSGGQRKRLAIALELVNNPPVMFF
DEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKLFELFDQLYVLSQGQCVYRGK
VCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCDSDHKRDLGGD
AEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDS
VLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLE
MGVFLREHLNYWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAAL
GTMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYIS
YVRYGFEGVILSIYGLDREDLHCDIDETCHFQKSEAILRELDVENAKLYLDFIVLGIFFI
SLRLIAYFVLRYKIRAER
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtctgatggccgctttctcggtcggcaccgccatgaatgccagcagttactct
gcagagatgacggagcccaagtcggtgtgtgtctcggtggatgaggtggtgtccagcaac
atggaggccactgagacggacctgctgaatggacatctgaaaaaagtagataataacctc
acggaagcccagcgcttctcctccttgcctcggagggcagctgtgaacattgaattcagg
gacctttcctattcggttcctgaaggaccctggtggaggaagaaaggatacaagaccctc
ctgaaaggaatttccgggaagttcaatagtggtgagttggtggccattatgggtccttcc
ggggccgggaagtccacgctgatgaacatcctggctggatacagggagacgggcatgaag
ggggccgtcctcatcaacggcctgccccgggacctgcgctgcttccggaaggtgtcctgc
tacatcatgcaggatgacatgctgctgccgcatctcactgtgcaggaggccatgatggtg
tcggcacatctgaagcttcaggagaaggatgaaggcagaagggaaatggtcaaggagata
ctgacagcgctgggcttgctgtcttgcgccaacacgcggaccgggagcctgtcaggtggt
cagcgcaagcgcctggccatcgcgctggagctggtgaacaaccctccagtcatgttcttc
gatgagcccaccagcggcctggacagcgcctcctgcttccaggtggtctcgctgatgaaa
gggctcgctcaagggggtcgctccatcatttgcaccatccaccagcccagcgccaaactc
ttcgagctgttcgaccagctttacgtcctgagtcaaggacaatgtgtgtaccggggaaaa
gtctgcaatcttgtgccatatttgagggatttgggtctgaactgcccaacctaccacaac
ccagcagattttgtcatggaggttgcatccggcgagtacggtgatcagaacagtcggctg
gtgagagcggttcgggagggcatgtgtgactcagaccacaagagagacctcgggggtgat
gccgaggtgaacccttttctttggcaccggccctctgaagaggtaaagcagacaaaacga
ttaaaggggttgagaaaggactcctcgtccatggaaggctgccacagcttctctgccagc
tgcctcacgcagttctgcatcctcttcaagaggaccttcctcagcatcatgagggactcg
gtcctgacacacctgcgcatcacctcgcacattgggatcggcctcctcattggcctgctg
tacttggggatcgggaacgaagccaagaaggtcttgagcaactccggcttcctcttcttc
tccatgctgttcctcatgttcgcggccctcatgcctactgttctgacatttcccctggag
atgggagtctttcttcgggaacacctgaactactggtacagcctgaaggcctactacctg
gccaagaccatggcagacgtgccctttcagatcatgttcccagtggcctactgcagcatc
gtgtactggatgacgtcgcagccgtccgacgccgtgcgctttgtgctgtttgccgcgctg
ggcaccatgacctccctggtggcacagtccctgggcctgctgatcggagccgcctccacg
tccctgcaggtggccactttcgtgggcccagtgacagccatcccggtgctcctgttctcg
gggttcttcgtcagcttcgacaccatccccacgtacctacagtggatgtcctacatctcc
tatgtcaggtatgggttcgaaggggtcatcctctccatctatggcttagaccgggaagat
ctgcactgtgacatcgacgagacgtgccacttccagaagtcggaggccatcctgcgggag
ctggacgtggaaaatgccaagctgtacctggacttcatcgtactcgggattttcttcatc
tccctccgcctcattgcctattttgtcctcaggtacaaaatccgggcagagaggtaa

DBGET integrated database retrieval system