KEGG   Homo sapiens (human): 962Help
Entry
962               CDS       T01001                                 

Gene name
CD48, BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48
Definition
(RefSeq) CD48 molecule
  KO
K06479  CD48 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    962 (CD48)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    962 (CD48)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    962 (CD48)
CD molecules [BR:hsa04090]
 Proteins
  962 (CD48)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  962 (CD48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 V-set I-set Receptor_2B4
Motif
Other DBs
NCBI-GeneID: 962
NCBI-ProteinID: NP_001769
OMIM: 109530
HGNC: 1683
Ensembl: ENSG00000117091
Vega: OTTHUMG00000024009
Pharos: P09326(Tbio)
UniProt: P09326
Structure
PDB: 

Position
1q23.3
AA seq 243 aa AA seqDB search
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFY
TFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE
WKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSV
LETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGL
LLT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccagaggttgggattcgtgtctggctctggaattgctactgctgcctctgtca
ctcctggtgaccagcattcaaggtcacttggtacatatgaccgtggtctccggcagcaac
gtgactctgaacatctctgagagcctgcctgagaactacaaacaactaacctggttttat
actttcgaccagaagattgtagaatgggattccagaaaatctaagtactttgaatccaaa
tttaaaggcagggtcagacttgatcctcagagtggcgcactgtacatctctaaggtccag
aaagaggacaacagcacctacatcatgagggtgttgaaaaagactgggaatgagcaagaa
tggaagatcaagctgcaagtgcttgaccctgtacccaagcctgtcatcaaaattgagaag
atagaagacatggatgacaactgttatctgaaactgtcatgtgtgatacctggcgagtct
gtaaactacacctggtatggggacaaaaggcccttcccaaaggagctccagaacagtgtg
cttgaaaccacccttatgccacataattactccaggtgttatacttgccaagtcagcaat
tctgtgagcagcaagaatggcacggtctgcctcagtccaccctgtaccctggcccggtcc
tttggagtagaatggattgcaagttggctagtggtcacggtgcccaccattcttggcctg
ttacttacctga

DBGET integrated database retrieval system