KEGG   Homo sapiens (human): 9625
Entry
9625              CDS       T01001                                 

Gene name
AATK, AATYK, AATYK1, LMR1, LMTK1, PPP1R77, p35BP
Definition
(RefSeq) apoptosis associated tyrosine kinase
  KO
K17480  lemur tyrosine kinase 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9625 (AATK)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9625 (AATK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     9625 (AATK)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  LMR family [OT]
   9625 (AATK)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9625 (AATK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 9625
NCBI-ProteinID: NP_001073864
OMIM: 605276
HGNC: 21
Ensembl: ENSG00000181409
Vega: OTTHUMG00000132717
Pharos: Q6ZMQ8(Tbio)
UniProt: Q6ZMQ8
Position
17q25.3
AA seq 1374 aa
MSSSFFNPSFAFSSHFDPDGAPLSELSWPSSLAVVAVSFSGLFAVIVLMLACLCCKKGGI
GFKEFENAEGDEYAADLAQGSPATAAQNGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDV
GRHSLLYLKEIGRGWFGKVFLGEVNSGISSAQVVVKELQASASVQEQMQFLEEVQPYRAL
KHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVAESMAPDPRTLQRMACEVACG
VLHLHRNNFVHSDLALRNCLLTADLTVKIGDYGLAHCKYREDYFVTADQLWVPLRWIAPE
LVDEVHSNLLVVDQTKSGNVWSLGVTIWELFELGTQPYPQHSDQQVLAYTVREQQLKLPK
PQLQLTLSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGATEAEEEFERRWRSLRPG
GGGVGPGPGAAGPMLGGVVELAAASSFPLLEQFAGDGFHADGDDVLTVTETSRGLNFEYK
WEAGRGAEAFPATLSPGRTARLQELCAPDGAPPGVVPVLSAHSPSLGSEYFIRLEEAAPA
AGHDPDCAGCAPSPPATADQDDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLA
RDPLCPSRSPSPSAGPLSLAEGGAEDADWGVAAFCPAFFEDPLGTSPLGSSGAPPLPLTG
EDELEEVGARRAAQRGHWRSNVSANNNSGSRCPESWDPVSAGGHAEGCPSPKQTPRASPE
PGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLAPAPCLVTPSWTETASSGGDHPQAEP
KLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEVSAIKL
ASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTP
DSLDSLDIPSSASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEP
QAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRA
PGPELGLPSTGQPSEQVCLRPGVSGEAQGSGPGEVLPPLLQLEGSSPEPSTCPSGLVPEP
PEPQGPAKVRPGPSPSCSQFFLLTPVPLRSEGNSSEFQGPPGLLSGPAPQKRMGGPGTPR
APLRLALPGLPAALEGRPEEEEEDSEDSDESDEELRCYSVQEPSEDSEEEAPAVPVVVAE
SQSARNLRSLLKMPSLLSETFCEDLERKKKAVSFFDDVTVYLFDQESPTRELGEPFPGAK
ESPPTFLRGSPGSPSAPNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPA
APAPAAPTPTPAPFSRFTVSPAPTSRFSITHVSDSDAESKRGPEAGAGGESKEA
NT seq 4125 nt   +upstreamnt  +downstreamnt
atgtcgtcgtccttcttcaaccccagcttcgccttcagctcgcacttcgaccccgacggc
gccccgctcagcgagctgtcctggccatcctccctcgccgtggtggctgtgtctttctcc
gggctcttcgccgtcatcgtcctcatgctggcctgcctgtgctgtaagaagggcggtatc
gggttcaaggagtttgagaatgcggagggggacgagtacgcagccgacctggcgcagggc
tccccggccacggcagcacagaacgggcccgacgtgtacgtcctgccactcacggaggtc
tccttgcccatggccaagcagcctgggcgctcagtgcagctcctcaagtccacagacgtg
ggccggcacagcctcctgtacctgaaggaaatcggccgtggctggttcgggaaggtgttc
ctgggggaggtgaactctggcatcagcagtgcccaggtggtggtgaaggagctgcaggct
agtgccagcgtgcaggagcagatgcagttcctggaggaggtgcagccctacagggccctg
aagcacagcaacctgctccagtgcctggcccagtgcgccgaggtgacgccctacctgctg
gtgatggagttctgcccactgggggacctcaagggctacctgcggagctgccgggtggcg
gagtccatggctcccgacccccggaccctgcagcgcatggcctgtgaggtggcctgtggc
gtcctgcaccttcatcgcaacaatttcgtgcacagcgacctggccctgcggaactgcctg
ctcacggctgacctgacggtgaagattggtgactatggcctggctcactgcaagtacaga
gaggactacttcgtgactgccgaccagctgtgggtgcctctgcgctggatcgcgccagag
ctggtggacgaggtgcatagcaacctgctcgtcgtggaccagaccaagagcgggaatgtg
tggtccctgggcgtgaccatctgggagctctttgagctgggcacgcagccctatccccag
cactcggaccagcaggtgctggcgtacacggtccgggagcagcagctcaagctgcccaag
ccccagctgcagctgaccctgtcggaccgctggtacgaggtgatgcagttctgctggctg
cagcccgagcagcggcccacagccgaggaggtgcacctgctgctgtcctacctgtgtgcc
aagggcgccaccgaagcagaggaggagtttgaacggcgctggcgctctctgcggcccggc
gggggcggcgtggggcccgggcccggtgcggcggggcccatgctgggcggcgtggtggag
ctcgccgctgcctcgtccttcccgctgctggagcagttcgcgggcgacggcttccacgcg
gacggcgacgacgtgctgacggtgaccgagaccagccgaggcctcaattttgagtacaag
tgggaggcgggccgcggcgcggaggccttcccggccacgctgagccctggccgcaccgca
cgcctgcaggagctgtgcgcccccgacggcgcgcccccgggcgtggttccggtgctcagc
gcgcacagcccgtcgctgggcagcgagtacttcatccgcctagaggaggccgcacccgcc
gccggccacgaccctgactgcgccggctgcgcccccagtccacctgccaccgcggaccag
gacgacgactctgacggcagcaccgccgcctcgctggccatggagccgctgctgggccac
gggccacccgtcgacgtcccctggggccgcggcgaccactaccctcgcagaagcttggcg
cgggacccgctctgcccctcacgctctccctcgccctcggcggggcccctgagtctggcg
gagggaggagcggaggatgcagactggggcgtggccgccttctgtcctgccttcttcgag
gacccactgggcacgtcccctttggggagctcaggggcgcccccgctgccgctgactggc
gaggatgagctagaggaggtgggagcgcggagggccgcccagcgcgggcactggcgctcc
aacgtgtcagccaacaacaacagcggcagccgctgtccagagtcctgggaccccgtctct
gcgggcggccacgctgagggctgccccagtccaaagcagaccccacgggcctcccccgag
ccggggtaccctggagagcctctgcttgggctccaggcagcctctgcccaggagccaggc
tgctgccccggcctccctcatctatgctctgcccagggcctggcacctgctccctgcctg
gttacaccctcctggacagagacagccagtagtgggggtgaccacccgcaggcagagccc
aagcttgccacggaggctgagggcactaccggaccccgcctgccccttccttccgtcccc
tccccatcccaggagggagccccacttccctcggaggaggccagtgcccccgacgcccct
gatgccctgcctgactctcccacgcctgctactggtggcgaggtgtctgccatcaagctg
gcttctgccctgaatggcagcagcagctctcccgaggtggaggcacccagcagtgaggat
gaggacacggccgaggccacctcaggcatcttcaccgacacgtccagcgacggcctgcag
gccaggaggccggatgtggtgccagccttccgctctctgcagaagcaggtggggaccccc
gactccctggactccctggacatcccgtcctcagccagtgatggtggctatgaggtcttc
agcccgtcggccactggcccctctggagggcagccgcgagcgctggacagtggctatgac
accgagaactatgagtcccctgagtttgtgctcaaggaggcgcaggaagggtgtgagccc
caggcctttgcggagctggcctcagagggtgagggccccgggcccgagacacggctctcc
acctccctcagtggcctcaacgagaagaatccctaccgagactctgcctacttctcagac
ctcgaggctgaggccgaggccacctcaggcccagagaagaagtgcggcggggaccgagcc
cccgggccagagctgggcctgccgagcactgggcagccgtctgagcaggtctgtctcagg
cctggggtttccggggaggcacaaggctctggccccggggaggtgctgcccccactgctg
cagcttgaagggtcctccccagagcccagcacctgcccctcgggcctggtcccagagcct
ccggagccccaaggcccagccaaggtgcggcctgggcccagccccagctgctcccagttt
ttcctgctgaccccggttccgctgagatcagaaggcaacagctctgagttccaggggccc
ccaggactgttgtcagggccggccccacaaaagcggatggggggcccaggcacccccaga
gccccactccgcctggctctgcccggcctccctgcggccttggagggccggccggaggag
gaggaggaggacagtgaggacagcgacgagtctgacgaggagctccgctgctacagcgtc
caggagcctagcgaggacagcgaagaggaggcgccggcggtgcccgtggtggtggctgag
agccagagcgcgcgcaacctgcgcagcctgctcaagatgcccagcctgctgtccgagacc
ttctgcgaggacctggaacgcaagaagaaggccgtgtccttcttcgacgacgtcaccgtc
tacctctttgaccaggaaagccccacccgggagctcggggagcccttcccgggcgccaag
gaatcgccccctacgttccttagggggagccccggctctcccagcgcccccaaccggccg
cagcaggctgatggctccccaaatggctccacagcggaagagggtggtgggttcgcgtgg
gacgacgacttcccgctgatgacggccaaggcagccttcgccatggccctagacccggcc
gcacccgccccggctgcgcccacgcccacgcccgctcccttctcgcgcttcacggtgtcg
cccgcgcccacgtcccgcttctccatcacgcacgtgtctgactcggacgccgagtccaag
agaggacctgaagctggtgccgggggtgagagtaaagaggcttga

DBGET integrated database retrieval system