KEGG   Homo sapiens (human): 9626Help
Entry
9626              CDS       T01001                                 

Gene name
GUCA1C, GCAP3
Definition
(RefSeq) guanylate cyclase activator 1C
  KO
K08328  guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    9626 (GUCA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg Dockerin_1 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 9626
NCBI-ProteinID: NP_005450
OMIM: 605128
HGNC: 4680
Ensembl: ENSG00000138472
Vega: OTTHUMG00000159204
Pharos: O95843(Tdark)
UniProt: O95843
Structure
PDB: 

Position
3q13.13
AA seq 209 aa AA seqDB search
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQV
YNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAV
QALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLR
VICNGKQPDMETDSSKSPDKAGLGKVKMK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggggaatggcaaatctatagctggtgatcagaaagcagttcctacacaagagacccat
gtgtggtacagaacatttatgatggaatatccatccggcctgcaaacactacatgaattt
aagacacttttgggtctgcaaggtctgaatcagaaggccaataaacatattgatcaagtt
tataatacctttgacacgaacaaggatggatttgttgactttttggagtttattgctgct
gtaaatctaatcatgcaagaaaaaatggagcaaaaattaaaatggtattttaagctgtat
gatgctgatggaaatggttctattgacaaaaatgaactactggacatgttcatggcggta
caagccctcaatggccagcaaactctgagtcctgaagaattcatcaacttggtgttccat
aagatcgatataaacaatgatggggaattgactttagaagaatttatcaatggcatggca
aaagatcaggatctcctggagattgtttacaagagcttcgacttctccaatgtgctgaga
gtaatctgtaatgggaagcagccagacatggagacagactcctccaaatctcctgacaag
gctggtctagggaaggtgaaaatgaagtag

DBGET integrated database retrieval system