KEGG   Homo sapiens (human): 9628Help
Entry
9628              CDS       T01001                                 

Gene name
RGS6, GAP, HA117, S914
Definition
(RefSeq) regulator of G protein signaling 6
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    9628 (RGS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS_DHEX RGS DEP G-gamma RGS-like
Motif
Other DBs
NCBI-GeneID: 9628
NCBI-ProteinID: NP_004287
OMIM: 603894
HGNC: 10002
Ensembl: ENSG00000182732
Vega: OTTHUMG00000171340
Pharos: P49758(Tbio)
UniProt: P49758 Q2M3K2
Structure
PDB: 

Position
14q24.2
AA seq 472 aa AA seqDB search
MAQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVV
TGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWP
SNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKI
DRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEES
QAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLI
TPAEPSNPWISDDVALWDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSS
ENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRY
TFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQSS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggatccggggatcaaagagcagtgggggttgctgacccagaggagagttct
ccaaacatgatcgtttactgcaaaattgaagacatcattacaaagatgcaagatgacaag
acagggggtgtgcccatcagaacagtcaagagctttctctccaaaatccccagtgtcgtc
acaggtactgacattgtgcagtggcttatgaagaacctttccattgaggacccagttgaa
gcaatacacttggggagccttatcgctgcccagggctacatctttccaatctcagaccat
gttctcaccatgaaggatgatggcaccttttatcgtttccaggctccgtacttctggcct
tcgaactgctgggaacctgaaaacactgactatgccatctatctctgtaagaggacaatg
caaaataaagcaaggctggaactggcagattatgaagcagaaaacttagcaagactccag
agggcctttgcgaggaagtgggaattcatctttatgcaagcagaagcacaagtaaagatt
gaccggaaaaaagacaagacagaaaggaaaattttggatagtcaagaacgagccttttgg
gatgtccacaggcctgtgccaggctgtgtgaacacaacagaaatggatatccgaaaatgt
cgacgtttgaagaatccacaaaaggttaaaaagtccgtgtatggcgtgactgaagagtcc
caggcacagagcccggtgcatgtactcagccaaccaatcaggaaaacaacaaaagaggac
atccggaaacagataacatttttgaacgcacagatcgacagacattgtttgaaaatgtcc
aaagtggctgaaagtttaattgcctacacggaacaatatgtggaatatgaccctttgata
acaccagctgagccatccaacccttggatcagcgatgacgttgctttgtgggacatagag
atgagcaaagagcccagccaacagcgagtaaaaagatggggcttctctttcgatgagata
ttgaaggaccaggtggggcgggaccagtttctacgattcctggagtccgaattcagttca
gaaaacctcaggttctggctggctgtccaagatcttaagaaacaacccctacaggatgtg
gccaagagggtagaagaaatctggcaagagtttctggctccaggggctccaagtgcaatc
aacctggattctcacagctatgagataaccagtcaaaatgtcaaagatggagggagatat
acatttgaagacgcccaggagcacatctacaagctgatgaagagtgacagctatgcccgc
ttcctccggtcaaatgcttaccaggatttgctgctggccaagaagaagggaaagtcgctg
gcgggcaagcgcctcacgggcctgatgcagtcctcctga

DBGET integrated database retrieval system