KEGG   Homo sapiens (human): 963Help
Entry
963               CDS       T01001                                 

Gene name
CD53, MOX44, TSPAN25
Definition
(RefSeq) CD53 molecule
  KO
K06489  CD53 antigen
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    963 (CD53)
   04090 CD molecules [BR:hsa04090]
    963 (CD53)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   963 (CD53)
CD molecules [BR:hsa04090]
 Proteins
  963 (CD53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 963
NCBI-ProteinID: NP_000551
OMIM: 151525
HGNC: 1686
Ensembl: ENSG00000143119
Vega: OTTHUMG00000048020
Pharos: P19397(Tbio)
UniProt: P19397
Position
1p13.3
AA seq 219 aa AA seqDB search
MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVG
SIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTD
SIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
NFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgagtagcttgaaactgctgaagtatgtcctgtttttcttcaacttgctcttt
tggatctgtggctgctgcattttgggctttgggatctacctgctgatccacaacaacttc
ggagtgctcttccataacctcccctccctcacgctgggcaatgtgtttgtcatcgtgggc
tctattatcatggtagttgccttcctgggctgcatgggctctatcaaggaaaacaagtgt
ctgcttatgtcgttcttcatcctgctgctgattatcctccttgctgaggtgaccttggcc
atcctgctctttgtatatgaacagaagctgaatgagtatgtggctaagggtctgaccgac
agcatccaccgttaccactcagacaatagcaccaaggcagcgtgggactccatccagtca
tttctgcagtgttgtggtataaatggcacgagtgattggaccagtggcccaccagcatct
tgcccctcagatcgaaaagtggagggttgctatgcgaaagcaagactgtggtttcattcc
aatttcctgtatatcggaatcatcaccatctgtgtatgtgtgattgaggtgttggggatg
tcctttgcactgaccctgaactgccagattgacaaaaccagccagaccatagggctatga

DBGET integrated database retrieval system