KEGG   Homo sapiens (human): 9636Help
Entry
9636              CDS       T01001                                 

Gene name
ISG15, G1P2, IFI15, IMD38, IP17, UCRP, hUCRP
Definition
(RefSeq) ISG15 ubiquitin-like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    9636 (ISG15)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    9636 (ISG15)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   9636 (ISG15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Ubiquitin_2 Rad60-SLD DUF2407
Motif
Other DBs
NCBI-GeneID: 9636
NCBI-ProteinID: NP_005092
OMIM: 147571
HGNC: 4053
Ensembl: ENSG00000187608
Vega: OTTHUMG00000040777
Pharos: P05161(Tbio)
UniProt: P05161
Structure
PDB: 

Position
1p36.33
AA seq 165 aa AA seqDB search
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggacctgacggtgaagatgctggcgggcaacgaattccaggtgtccctgagc
agctccatgtcggtgtcagagctgaaggcgcagatcacccagaagatcggcgtgcacgcc
ttccagcagcgtctggctgtccacccgagcggtgtggcgctgcaggacagggtccccctt
gccagccagggcctgggccccggcagcacggtcctgctggtggtggacaaatgcgacgaa
cctctgagcatcctggtgaggaataacaagggccgcagcagcacctacgaggtacggctg
acgcagaccgtggcccacctgaagcagcaagtgagcgggctggagggtgtgcaggacgac
ctgttctggctgaccttcgaggggaagcccctggaggaccagctcccgctgggggagtac
ggcctcaagcccctgagcaccgtgttcatgaatctgcgcctgcggggaggcggcacagag
cctggcgggcggagctaa

DBGET integrated database retrieval system