KEGG   Homo sapiens (human): 9639
Entry
9639              CDS       T01001                                 

Gene name
ARHGEF10, GEF10, SNCV
Definition
(RefSeq) Rho guanine nucleotide exchange factor 10
  KO
K16727  Rho guanine nucleotide exchange factor 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9639 (ARHGEF10)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9639 (ARHGEF10)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    9639 (ARHGEF10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     9639 (ARHGEF10)
SSDB
Motif
Pfam: WD40_2 PH_19 RhoGEF
Other DBs
NCBI-GeneID: 9639
NCBI-ProteinID: NP_001295082
OMIM: 608136
HGNC: 14103
Ensembl: ENSG00000104728
Vega: OTTHUMG00000163626
Pharos: O15013(Tbio)
UniProt: O15013
Position
8p23.3
AA seq 1368 aa
MRPPGFLSRAPSLNRAERGIWSCSMDQREPLPPAPAENEMKYDTNNNEEEEGEQFDFDSG
DEIPEADRQAPSAPETGGAGASEAPAPTGGEDGAGAETTPVAEPTKLVLPMKVNPYSVID
ITPFQEDQPPTPVPSAEEENVGLHVPCGYLVPVPCGYAVPSNLPLLLPAYSSPVIICATS
LDEEAETPEVTEDRQPNSLSSEEPPTSEDQVGREDSALARWAADPANTAWMENPEEAIYD
DVPRENSDSEPDEMIYDDVENGDEGGNSSLEYGWSSSEFESYEEQSDSECKNGIPRSFLR
SNHKKQLSHDLTRLKEHYEKKMRDLMASTVGVVEIQQLRQKHELKMQKLVKAAKDGTKDG
LERTRAAVKRGRSFIRTKSLIAQDHRSSLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQV
VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVKEILQCHSL
FQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFL
EFLKEQEASPDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETL
AEKLNERKRDADQRCEVKQIAKAINERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVKT
KERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSVPLGHVDAIEYGSSAGTGEHSR
HLAVHPPESLAVVANAKPNKVYMGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLN
QSVAHDWTSGLQRLILKKEDEIRAADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIKE
SWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAY
NPEPYLNNESQPDSFSTAHGFLWIGSCTHQMGQIAIVSFQNSTPKVIECFNVESRILCML
YVPVEEKRREPGAPPDPETPAVRASDVPTICVGTEEGSISIYKSSQGSKKVRLQHFFTPE
KSTVMSLACTSQSLYAGLVNGAVASYARAPDGSWDSEPQKVIKLGVLPVRSLLMMEDTLW
AASGGQVFIISVETHAVEGQLEAHQEEGMVISHMAVSGVGIWIAFTSGSTLRLFHTETLK
HLQDINIATPVHNMLPGHQRLSVTSLLVCHGLLMVGTSLGVLVALPVPRLQGIPKVTGRG
MVSYHAHNSPVKFIVLATALHEKDKDKSRDSLAPGPEPQDEDQKDALPSGGAGSSLSQGD
PDAAIWLGDSLGSMTQKSDLSSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDPVSLRSKAR
RAKKAKASSALVVCGGQGHRRVHRKARQPHQEELAPTVMVWQIPLLNI
NT seq 4107 nt   +upstreamnt  +downstreamnt
atgagacctccaggatttctcagcagagctccttcccttaacagagctgagagaggcatc
tggagctgcagcatggaccagcgagagcccctgcctcccgctcctgcagaaaatgaaatg
aaatatgataccaataataatgaagaggaagagggagaacagttcgattttgacagtgga
gatgaaatcccagaagcggacagacaggccccatccgcccctgagacaggaggtgctgga
gccagtgaagcccctgcacccacaggaggtgaggatggagctggagcagaaaccacccca
gtggcagagcctactaagctggtgctcccgatgaaagtcaacccatattctgtcatcgac
atcacgccattccaggaggaccagccgcccacccccgtgcccagcgctgaggaggagaat
gtgggtctccatgtgccctgcgggtacttggtgcctgtaccctgcggctatgcggtgccc
tccaacctgcccctcctgctgcccgcctactccagcccggtcatcatctgcgccacgtcc
ctggacgaagaagcagaaacaccagaagtcacagaagatcgccagcccaattctctgagt
tccgaggagcctccaaccagtgaagatcaagtcggtcgagaggacagcgcacttgcccgc
tgggccgcagacccggccaacacagcctggatggagaatccagaggaagcaatttacgat
gacgttccaagggaaaactcagactctgaaccagatgaaatgatttatgatgatgttgag
aatggggatgaaggtggaaacagctccttggaatacggatggagttcgagtgaatttgaa
agttacgaagagcagagtgactcggagtgcaagaatgggattcccaggtccttcctgcgc
agcaaccacaaaaagcaactttctcatgacctaacccgtttaaaggagcactatgagaaa
aagatgagagatttgatggcaagcacggtgggcgtggtggagattcagcagctcaggcag
aagcatgaactgaagatgcagaagctcgtgaaggccgcgaaggacggcaccaaggacggg
ctggagaggaccagggcagccgtgaagaggggccgctccttcatcaggaccaagtctctc
atcgcacaggatcacagatcttctcttgaggaagaacagaatttgttcattgatgttgac
tgcaagcacccggaagccatcttgaccccgatgcccgagggtttatctcagcagcaggtt
gtaagaagatatatactgggttcagttgtcgacagtgaaaagaactacgtagatgctctt
aagaggattttggagcaatatgagaagccgctgtctgagatggagccaaaggttctgagt
gagaggaagctgaagacggtgttctaccgagtcaaagagatcctgcagtgccactcgcta
tttcagatcgcgctggccagccgcgtttccgagtgggactccgtggaaatgataggcgat
gtcttcgtggcttcgttttctaagtccatggtgctggatgcatacagtgaatatgtgaac
aatttcagcacagccgtggcagtcctcaagaaaacatgtgccacaaagcccgcttttctt
gaatttttaaaggaacaggaggccagccccgatcgaaccacgctctacagcctgatgatg
aagcccatccagaggttcccacagttcatcctcctgctccaggacatgctgaagaacacc
tccaaaggccaccccgacaggctgcctcttcagatggccctgacagagctcgaaacacta
gcagagaagttaaatgaaagaaagagagatgctgatcaacgctgtgaagtgaagcaaata
gccaaagccataaacgaaagatacctgaacaagcttctcagcagtggaagccgatacctc
attcgatcagatgatatgatagaaacagtttacaacgacagaggagagattgttaaaacc
aaagaacgccgagtcttcatgttaaatgatgtgttaatgtgtgccaccgtcagctcacgc
ccctctcatgacagccgtgtgatgagcagccagaggtacttgctgaagtggagcgttcca
ctgggacatgtggacgccatcgagtatggcagcagcgcaggcacgggcgagcacagcagg
caccttgccgttcacccgccggagagcctggccgtggttgctaacgcgaaaccaaacaaa
gtttacatggggccaggacaactgtatcaagatttacaaaacttgttgcatgacttaaat
gtaattggccaaatcactcagctgataggaaaccttaaaggaaactatcagaacttaaac
cagtcagtagcccatgactggacatcaggtttacaaaggcttattttgaagaaagaagat
gaaatcagagctgcggactgctgcagaattcagttacagcttcccgggaagcaggacaaa
tctgggcgaccgacgttctttacagctgtgttcaatacgttcacccctgccatcaaggag
tcctgggtcaacagcttacagatggccaagctcgccctagaagaggagaaccacatgggc
tggttctgtgtggaagacgatgggaatcacattaaaaaggagaagcatcctctcctcgtc
ggacacatgcccgtgatggtggccaagcagcaggagttcaagattgaatgtgctgcttat
aaccctgaaccttacctaaataatgaaagccagccagattcattttccacggcacatggt
ttcctgtggatcggaagttgcacccatcaaatgggtcagattgccatcgtctcgtttcaa
aattccactcccaaagtcattgagtgcttcaacgtggaatctcgcatcctgtgcatgctg
tacgttcccgtcgaggagaagcgcagagagcctggggcacccccggaccccgagaccccg
gccgtgagagcttctgatgtccccacgatctgtgtagggacggaggagggaagcatttcc
atttataaaagcagtcaaggctccaagaaagtgagacttcagcactttttcactcctgag
aagtccacagtcatgagcctggcttgcacgtctcagagcctgtacgctggcctggtcaac
ggggcagtcgccagctacgccagagccccagatggatcctgggattcagaacctcaaaaa
gtgatcaagttaggcgtcctaccagttagaagtctactcatgatggaagacacgttgtgg
gcggcttccggaggtcaagtcttcatcatcagtgtggagactcatgctgtagagggtcag
ctggaggcccaccaggaggaaggcatggtgatctcccacatggccgtgtccggcgtcggg
atctggattgccttcacctcagggtccacgctccgcctttttcacacggaaactctcaag
cacctgcaggacatcaacatcgccacccctgttcacaacatgctgccagggcaccagcgg
ctgtcggtgacgagcctgctcgtctgccacggattgctgatggtcggcaccagcctggga
gtcctcgtggccctgccggtcccacgtctgcaagggattcccaaagtgaccggaagaggc
atggtctcctaccatgcacacaacagtcctgtcaaattcatcgtcctggccacggctctg
cacgagaaagacaaggacaaatccagggacagcctggctcctggccccgagcctcaggac
gaagaccagaaggacgcacttccgagtggaggagctggttcatctctgagccagggtgac
cctgacgcagccatctggttgggagattcgctgggatcgatgactcagaaaagcgacctg
tcctcctcatctgggtccctgagcttgtctcacggctccagctctctagagcacagatca
gaggacagcaccatctatgatctcctgaaggatcctgtctcgctgagaagcaaagcacgc
cgggccaagaaagccaaggccagctcggcgctggtggtctgtggagggcagggccaccgc
cgggtgcacaggaaggcccggcagccccaccaggaagagctggcgccgaccgtcatggtc
tggcagatccctctgctgaatatataa

DBGET integrated database retrieval system