KEGG   Homo sapiens (human): 9640Help
Entry
9640              CDS       T01001                                 

Gene name
ZNF592, CAMOS, SCAR5
Definition
(RefSeq) zinc finger protein 592
  KO
K19325  zinc finger protein 592
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    9640 (ZNF592)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_11 zf-C2H2_4 zf-C2H2 zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 9640
NCBI-ProteinID: NP_055445
OMIM: 613624
HGNC: 28986
Ensembl: ENSG00000166716
Vega: OTTHUMG00000172490
Pharos: Q92610(Tbio)
UniProt: Q92610
Position
15q25.3
AA seq 1267 aa AA seqDB search
MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSA
PDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSA
RSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGG
PVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGE
ALEFNSHPSNSIGESKGLARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVT
KEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKG
SPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSE
MPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPRVPKGAAPGSQTG
KKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPL
VHQVKKAAPLIVEVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLECGDAFALEK
SLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQ
MFVSAPVNSTAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQM
RDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPYCCPECGVLCRSA
YFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTAS
STADHSATQHPTQPHRPSQLIYKCSCEMVFNKKRHIQQHFYQNVSKTQVGVFKCPECPLL
FVQKPELMQHVKSTHGVPRNVDELSSLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPS
GRWGRPEAHRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQ
SFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLMHGIRNPDLSQTS
KVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQ
SHIPQHQVDSSTAQCLLCGLCYTSASSLSRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAE
PEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDS
HTLSPQV
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgggggatatgaaaaccccagattttgatgaccttctggctgcctttgacatcccagac
cccaccagccttgatgccaaggaggccatccagacacccagtgaggagaatgagagtccc
ctcaaacctccaggcatatgtatggatgaaagtgtgtccttgtctcactcaggatcagcc
cccgatgtgccggccgtgagtgtcattgtcaagaacaccagccgccaggagtcatttgaa
gcggagaaagaccacattactcccagtctcctacacaatggattccggggctcagatctg
cctccagatccccacaactgtgggaaatttgattctacttttatgaatggagacagtgcc
aggagtttccctggcaaactggagcctcccaagtcagagccattacccaccttcaaccag
ttcagtccaatctccagcccagaacctgaggatcccatcaaagataacggatttgggata
aagcccaaacactctgacagttatttcccaccccctcttgggtgcggggctgtgggaggc
ccagtcctggaggctctggctaagtttccggttccagagctgcatatgtttgatcatttt
tgtaagaaagaacccaagccagaacccctgcccttggggagccagcaggaacacgagcaa
agtgggcagaacacagtggaacctcacaaggatccggatgccactcgattcttcggggaa
gctttggagttcaacagccatcctagcaacagtattggagagtccaaggggcttgcccgg
gagcttggtacctgctcatcagtcccccctaggcagcgtctaaagccagctcattccaag
ctgtcctcttgtgtggcagccttggtggccttgcaggccaaaagagtggctagtgtcact
aaggaggatcagcctggccacacaaaggatctctcagggcccactaaagagagttctaaa
ggtagccccaaaatgcccaagtcaccaaagagtccccggagccctctggaggccactaga
aaaagtatcaagccatcggacagccctcgtagcatctgcagtgacagcagcagcaaaggc
tcaccgtctgtggctgccagctccccaccagcaattcccaaagtgagaatcaaaaccatt
aagacatcatcaggggaaatcaaacggactgtcacaaggatcctgccagatcctgatgat
ccaagtaagtcccctgttgggtcacctctagggagcgccattgcagaggcccccagcgag
atgccaggggatgaggtgcctgtggaagagcactttcctgaggcaggcacaaattcaggg
agcccccagggggccaggaaaggggacgagagcatgacaaaggccagtgactcgtcatct
cccagctgcagttctgggccccgggtcccaaagggggctgccccaggctcacagacaggc
aagaagcaacagagcacagcactgcaggcatccaccctggcccctgccaacctcctgccc
aaagccgtgcacttggccaacctgaacctcgtcccccacagtgttgctgcatcagtgaca
gccaagtcttcagtgcaaagacggagccagccacagcttacacaaatgtcggtgcccctg
gtccaccaggtgaaaaaggctgccccactgattgtagaggtcttcaacaaggtccttcac
agctccaaccccgtgcccctctatgcgccaaatctcagcccgcctgcggacagcaggatc
cacgtgccggccagtgggtactgctgcctggagtgtggagacgcatttgccttagagaag
agcctgagccagcactatggccggcggagcgtccacattgaggtactgtgcacactgtgc
tccaagacgctgctcttcttcaacaagtgcagcctgctccggcacgcccgtgaccacaag
agcaaggggctcgtcatgcagtgttcccagctgctggtgaagcctatctctgcggaccaa
atgttcgtgtcggcccctgtgaactccacggcaccagcagccccagccccttcatcctct
cccaaacatggcctcacttcgggcagtgccagtccccctcctccagccttgccactctac
ccagaccctgtgaggctcatccggtactcaatcaagtgtcttgaatgtcacaagcagatg
cgggactacatggtcctggctgcacatttccagaggacaacagaggagacagaggggctg
acctgccaggtatgccaaatgctgctgcccaaccagtgcagtttctgtgcccaccagcgg
attcatgcacacaagtccccctactgctgcccggagtgtggggtcctctgccgctctgcc
tacttccagacccatgtaaaggagaattgcctgcactatgcccgcaaggtgggctacagg
tgcatccactgtggtgtcgtccacctgaccttggccttgctgaaaagccacatccaggag
cgacactgccaggttttccacaaatgtgcattctgccccatggccttcaagactgccagc
agcactgcagaccacagtgccacccagcaccccacccagccccacagaccctcccagctc
atttataagtgctcctgtgaaatggtcttcaacaagaagaggcacattcagcagcatttt
taccagaatgtcagcaagacgcaggtgggcgtcttcaagtgccctgagtgcccactcttg
ttcgtgcagaagccggagttgatgcaacacgtcaagagcacccacggtgttccccgaaat
gtggacgagctgtcaagcctccagtcttcagcggacacatcctcaagccgccctggctct
cgagttcccactgagccaccagccactagtgtggctgctcggagcagctccctgccttct
ggccgctggggtaggcctgaagcccaccgcagggtggaagccaggccgcggctgaggaac
actggctggacctgccaggagtgccaggagtgggttccagatcgggagagctacgtgtcc
cacatgaaaaagagccacggtcggacattgaagcggtacccatgccggcagtgtgaacag
tccttccacacccccaacagcctgcgcaaacacatccgcaacaaccatgacacagtaaag
aagttctacacctgcgggtactgcacagaggacagccccagctttcctcggccctccctt
ctggagagccacatcagccttatgcatggcatcagaaaccctgatttgagccagacgtcc
aaagtgaaacctccgggtggacattcccctcaggtgaaccatctgaaaagaccagtcagt
ggagtgggggacgctccaggcaccagcaatggcgcaactgtctcttccaccaaaaggcac
aagtccctttttcagtgcgcgaaatgtagttttgccacagactcggggctcgagtttcag
agccacatacctcagcaccaggtggacagctccacagcccaatgtctcctctgtggtttg
tgctacacctctgccagctccctcagccgccacctcttcattgtccacaaggtgagagac
caggaggaggaggaggaagaggaggcggcggcagcggagatggcagtggaggtggcagag
ccagaggagggctccggggaggaggtgcccatggagactagagagaatggactggaagaa
tgtgccggtgagcctttgtcagctgacccagaggcgaggagattgctgggcccggcccct
gaggacgatggtggccacaatgatcacagtcaaccacaggcctctcaggaccaggacagc
cacacactgtcccctcaggtgtga

DBGET integrated database retrieval system